ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1oewA_ALL_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 2 months ago) by hstehr
File size: 26269 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3     #PDB: 1oew
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: ALL
8     #CUTOFF: 5.0
9     1 2 1.000
10     1 3 1.000
11     1 98 1.000
12     1 150 1.000
13     1 151 1.000
14     1 152 1.000
15     1 170 1.000
16     1 171 1.000
17     2 3 1.000
18     2 4 1.000
19     2 96 1.000
20     2 97 1.000
21     2 98 1.000
22     2 151 1.000
23     2 152 1.000
24     2 170 1.000
25     2 171 1.000
26     2 172 1.000
27     3 4 1.000
28     3 5 1.000
29     3 95 1.000
30     3 96 1.000
31     3 97 1.000
32     3 98 1.000
33     3 168 1.000
34     3 169 1.000
35     3 170 1.000
36     3 172 1.000
37     4 5 1.000
38     4 6 1.000
39     4 95 1.000
40     4 96 1.000
41     4 97 1.000
42     4 167 1.000
43     4 168 1.000
44     4 169 1.000
45     4 170 1.000
46     4 172 1.000
47     5 6 1.000
48     5 7 1.000
49     5 19 1.000
50     5 20 1.000
51     5 95 1.000
52     5 96 1.000
53     5 166 1.000
54     5 167 1.000
55     5 168 1.000
56     5 169 1.000
57     6 7 1.000
58     6 8 1.000
59     6 18 1.000
60     6 19 1.000
61     6 20 1.000
62     6 165 1.000
63     6 166 1.000
64     6 167 1.000
65     7 8 1.000
66     7 9 1.000
67     7 17 1.000
68     7 18 1.000
69     7 19 1.000
70     7 159 1.000
71     7 160 1.000
72     7 164 1.000
73     7 165 1.000
74     7 166 1.000
75     7 167 1.000
76     7 168 1.000
77     8 9 1.000
78     8 10 1.000
79     8 16 1.000
80     8 17 1.000
81     8 18 1.000
82     8 165 1.000
83     9 10 1.000
84     9 11 1.000
85     9 14 1.000
86     9 16 1.000
87     9 17 1.000
88     9 18 1.000
89     9 161 1.000
90     9 163 1.000
91     9 164 1.000
92     9 165 1.000
93     10 11 1.000
94     10 12 1.000
95     10 15 1.000
96     10 16 1.000
97     10 17 1.000
98     10 18 1.000
99     10 118 1.000
100     10 120 1.000
101     10 121 1.000
102     11 12 1.000
103     11 13 1.000
104     11 14 1.000
105     11 15 1.000
106     11 16 1.000
107     12 13 1.000
108     12 14 1.000
109     12 163 1.000
110     13 14 1.000
111     13 15 1.000
112     13 163 1.000
113     13 279 1.000
114     13 280 1.000
115     13 281 1.000
116     13 310 1.000
117     14 15 1.000
118     14 16 1.000
119     14 17 1.000
120     14 161 1.000
121     14 162 1.000
122     14 163 1.000
123     14 164 1.000
124     14 222 1.000
125     14 279 1.000
126     14 306 1.000
127     14 310 1.000
128     15 16 1.000
129     15 17 1.000
130     15 222 1.000
131     15 279 1.000
132     15 306 1.000
133     16 17 1.000
134     16 18 1.000
135     16 33 1.000
136     16 121 1.000
137     16 222 1.000
138     16 306 1.000
139     17 18 1.000
140     17 19 1.000
141     17 32 1.000
142     17 33 1.000
143     17 34 1.000
144     17 160 1.000
145     17 161 1.000
146     17 162 1.000
147     17 163 1.000
148     17 164 1.000
149     17 306 1.000
150     17 310 1.000
151     18 19 1.000
152     18 20 1.000
153     18 31 1.000
154     18 32 1.000
155     18 33 1.000
156     18 120 1.000
157     18 121 1.000
158     19 20 1.000
159     19 21 1.000
160     19 30 1.000
161     19 31 1.000
162     19 32 1.000
163     19 34 1.000
164     19 95 1.000
165     19 168 1.000
166     20 21 1.000
167     20 22 1.000
168     20 29 1.000
169     20 30 1.000
170     20 31 1.000
171     20 32 1.000
172     20 34 1.000
173     20 94 1.000
174     20 95 1.000
175     20 96 1.000
176     21 22 1.000
177     21 23 1.000
178     21 28 1.000
179     21 29 1.000
180     21 30 1.000
181     21 31 1.000
182     21 32 1.000
183     21 34 1.000
184     21 93 1.000
185     21 94 1.000
186     21 95 1.000
187     21 125 1.000
188     22 23 1.000
189     22 24 1.000
190     22 27 1.000
191     22 28 1.000
192     22 29 1.000
193     22 92 1.000
194     22 93 1.000
195     22 94 1.000
196     22 95 1.000
197     22 96 1.000
198     23 24 1.000
199     23 25 1.000
200     23 26 1.000
201     23 27 1.000
202     23 28 1.000
203     23 29 1.000
204     23 30 1.000
205     23 32 1.000
206     23 41 1.000
207     23 43 1.000
208     23 58 1.000
209     23 91 1.000
210     23 92 1.000
211     23 93 1.000
212     23 105 1.000
213     24 25 1.000
214     24 26 1.000
215     24 27 1.000
216     24 28 1.000
217     24 58 1.000
218     24 63 1.000
219     24 65 1.000
220     24 91 1.000
221     24 92 1.000
222     25 26 1.000
223     25 27 1.000
224     25 62 1.000
225     25 63 1.000
226     25 64 1.000
227     25 65 1.000
228     25 91 1.000
229     25 92 1.000
230     26 27 1.000
231     26 28 1.000
232     26 62 1.000
233     27 28 1.000
234     27 29 1.000
235     28 29 1.000
236     28 30 1.000
237     28 57 1.000
238     28 58 1.000
239     28 59 1.000
240     28 60 1.000
241     28 62 1.000
242     28 63 1.000
243     29 30 1.000
244     29 31 1.000
245     29 56 1.000
246     30 31 1.000
247     30 32 1.000
248     30 43 1.000
249     30 44 1.000
250     30 56 1.000
251     30 57 1.000
252     30 58 1.000
253     30 122 1.000
254     31 32 1.000
255     31 33 1.000
256     31 120 1.000
257     31 121 1.000
258     31 122 1.000
259     31 123 1.000
260     32 33 1.000
261     32 34 1.000
262     32 41 1.000
263     32 42 1.000
264     32 43 1.000
265     32 122 1.000
266     32 123 1.000
267     32 124 1.000
268     32 125 1.000
269     33 34 1.000
270     33 35 1.000
271     33 121 1.000
272     33 123 1.000
273     33 124 1.000
274     33 125 1.000
275     33 219 1.000
276     33 220 1.000
277     34 35 1.000
278     34 36 1.000
279     34 95 1.000
280     34 125 1.000
281     34 127 1.000
282     34 168 1.000
283     34 170 1.000
284     34 219 1.000
285     34 220 1.000
286     35 36 1.000
287     35 37 1.000
288     35 38 1.000
289     35 78 1.000
290     35 124 1.000
291     35 125 1.000
292     35 126 1.000
293     35 127 1.000
294     35 128 1.000
295     35 218 1.000
296     35 219 1.000
297     35 220 1.000
298     35 221 1.000
299     36 37 1.000
300     36 38 1.000
301     36 127 1.000
302     36 128 1.000
303     36 156 1.000
304     36 194 1.000
305     36 217 1.000
306     36 218 1.000
307     36 219 1.000
308     36 220 1.000
309     36 316 1.000
310     37 38 1.000
311     37 39 1.000
312     37 128 1.000
313     37 132 1.000
314     37 193 1.000
315     37 216 1.000
316     37 217 1.000
317     37 218 1.000
318     37 219 1.000
319     37 220 1.000
320     38 39 1.000
321     38 40 1.000
322     38 76 1.000
323     38 78 1.000
324     38 124 1.000
325     38 126 1.000
326     38 127 1.000
327     38 128 1.000
328     39 40 1.000
329     39 41 1.000
330     39 106 1.000
331     39 126 1.000
332     39 127 1.000
333     39 128 1.000
334     39 129 1.000
335     39 130 1.000
336     39 132 1.000
337     39 133 1.000
338     39 140 1.000
339     39 142 1.000
340     39 192 1.000
341     40 41 1.000
342     40 42 1.000
343     40 74 1.000
344     40 76 1.000
345     40 78 1.000
346     40 106 1.000
347     40 124 1.000
348     40 125 1.000
349     40 126 1.000
350     40 132 1.000
351     40 133 1.000
352     40 134 1.000
353     40 135 1.000
354     41 42 1.000
355     41 43 1.000
356     41 93 1.000
357     41 103 1.000
358     41 104 1.000
359     41 105 1.000
360     41 106 1.000
361     41 124 1.000
362     41 125 1.000
363     41 126 1.000
364     41 143 1.000
365     42 43 1.000
366     42 44 1.000
367     42 74 1.000
368     42 76 1.000
369     42 78 1.000
370     42 84 1.000
371     42 106 1.000
372     42 108 1.000
373     42 111 1.000
374     42 115 1.000
375     42 122 1.000
376     42 123 1.000
377     42 124 1.000
378     43 44 1.000
379     43 45 1.000
380     43 48 1.000
381     43 58 1.000
382     43 105 1.000
383     43 106 1.000
384     43 107 1.000
385     43 108 1.000
386     43 122 1.000
387     43 123 1.000
388     44 45 1.000
389     44 46 1.000
390     44 48 1.000
391     44 52 1.000
392     44 53 1.000
393     44 55 1.000
394     44 56 1.000
395     44 57 1.000
396     44 58 1.000
397     44 108 1.000
398     44 111 1.000
399     44 115 1.000
400     44 116 1.000
401     44 121 1.000
402     44 122 1.000
403     44 123 1.000
404     45 46 1.000
405     45 47 1.000
406     45 48 1.000
407     45 53 1.000
408     45 57 1.000
409     45 58 1.000
410     45 60 1.000
411     45 107 1.000
412     45 108 1.000
413     46 47 1.000
414     46 48 1.000
415     46 57 1.000
416     46 58 1.000
417     46 59 1.000
418     46 60 1.000
419     47 48 1.000
420     47 49 1.000
421     47 60 1.000
422     47 87 1.000
423     47 89 1.000
424     47 107 1.000
425     47 108 1.000
426     47 109 1.000
427     48 49 1.000
428     48 50 1.000
429     48 52 1.000
430     48 53 1.000
431     48 108 1.000
432     48 109 1.000
433     48 110 1.000
434     48 111 1.000
435     49 50 1.000
436     49 51 1.000
437     49 52 1.000
438     49 53 1.000
439     49 109 1.000
440     49 110 1.000
441     50 51 1.000
442     50 52 1.000
443     50 53 1.000
444     51 52 1.000
445     51 53 1.000
446     51 116 1.000
447     52 53 1.000
448     52 55 1.000
449     52 109 1.000
450     52 110 1.000
451     52 111 1.000
452     52 116 1.000
453     53 55 1.000
454     53 57 1.000
455     53 116 1.000
456     55 56 1.000
457     55 57 1.000
458     55 115 1.000
459     55 116 1.000
460     55 117 1.000
461     55 118 1.000
462     55 119 1.000
463     55 121 1.000
464     55 122 1.000
465     56 57 1.000
466     56 58 1.000
467     56 122 1.000
468     57 58 1.000
469     57 59 1.000
470     58 59 1.000
471     58 60 1.000
472     58 63 1.000
473     58 66 1.000
474     58 89 1.000
475     58 91 1.000
476     58 105 1.000
477     59 60 1.000
478     59 61 1.000
479     59 62 1.000
480     59 63 1.000
481     60 61 1.000
482     60 62 1.000
483     60 63 1.000
484     60 66 1.000
485     60 89 1.000
486     60 107 1.000
487     61 62 1.000
488     61 63 1.000
489     62 63 1.000
490     62 64 1.000
491     63 64 1.000
492     63 65 1.000
493     63 66 1.000
494     63 91 1.000
495     64 65 1.000
496     64 66 1.000
497     65 66 1.000
498     65 67 1.000
499     65 90 1.000
500     65 91 1.000
501     65 92 1.000
502     66 67 1.000
503     66 68 1.000
504     66 89 1.000
505     66 90 1.000
506     66 91 1.000
507     67 68 1.000
508     67 69 1.000
509     67 88 1.000
510     67 89 1.000
511     67 90 1.000
512     68 69 1.000
513     68 70 1.000
514     68 87 1.000
515     68 88 1.000
516     68 89 1.000
517     68 90 1.000
518     69 70 1.000
519     69 71 1.000
520     69 72 1.000
521     69 88 1.000
522     69 89 1.000
523     69 90 1.000
524     69 135 1.000
525     69 140 1.000
526     70 71 1.000
527     70 72 1.000
528     71 72 1.000
529     71 73 1.000
530     71 136 1.000
531     71 137 1.000
532     72 73 1.000
533     72 74 1.000
534     72 86 1.000
535     72 87 1.000
536     72 88 1.000
537     72 135 1.000
538     72 136 1.000
539     72 137 1.000
540     73 74 1.000
541     73 75 1.000
542     73 86 1.000
543     73 87 1.000
544     73 88 1.000
545     73 134 1.000
546     73 135 1.000
547     73 136 1.000
548     74 75 1.000
549     74 76 1.000
550     74 84 1.000
551     74 85 1.000
552     74 86 1.000
553     74 87 1.000
554     74 88 1.000
555     74 106 1.000
556     74 107 1.000
557     74 108 1.000
558     74 134 1.000
559     74 135 1.000
560     75 76 1.000
561     75 77 1.000
562     75 84 1.000
563     75 85 1.000
564     75 134 1.000
565     76 77 1.000
566     76 78 1.000
567     76 82 1.000
568     76 83 1.000
569     76 84 1.000
570     76 134 1.000
571     77 78 1.000
572     77 79 1.000
573     77 82 1.000
574     77 83 1.000
575     78 79 1.000
576     78 80 1.000
577     78 81 1.000
578     78 82 1.000
579     78 83 1.000
580     78 84 1.000
581     78 115 1.000
582     78 124 1.000
583     79 80 1.000
584     79 81 1.000
585     80 81 1.000
586     80 82 1.000
587     80 114 1.000
588     81 82 1.000
589     81 83 1.000
590     82 83 1.000
591     82 84 1.000
592     82 112 1.000
593     82 114 1.000
594     82 115 1.000
595     83 84 1.000
596     83 85 1.000
597     83 110 1.000
598     83 111 1.000
599     83 112 1.000
600     83 115 1.000
601     84 85 1.000
602     84 86 1.000
603     84 108 1.000
604     84 110 1.000
605     84 111 1.000
606     84 112 1.000
607     84 115 1.000
608     85 86 1.000
609     85 87 1.000
610     85 107 1.000
611     85 108 1.000
612     85 109 1.000
613     85 110 1.000
614     86 87 1.000
615     86 88 1.000
616     86 107 1.000
617     86 108 1.000
618     86 109 1.000
619     87 88 1.000
620     87 89 1.000
621     87 105 1.000
622     87 106 1.000
623     87 107 1.000
624     87 109 1.000
625     88 89 1.000
626     88 90 1.000
627     88 104 1.000
628     88 105 1.000
629     88 106 1.000
630     88 107 1.000
631     88 135 1.000
632     88 140 1.000
633     89 90 1.000
634     89 91 1.000
635     89 103 1.000
636     89 104 1.000
637     89 105 1.000
638     89 106 1.000
639     89 107 1.000
640     90 91 1.000
641     90 92 1.000
642     90 102 1.000
643     90 103 1.000
644     90 104 1.000
645     90 105 1.000
646     90 140 1.000
647     91 92 1.000
648     91 93 1.000
649     91 100 1.000
650     91 101 1.000
651     91 102 1.000
652     91 103 1.000
653     91 105 1.000
654     92 93 1.000
655     92 94 1.000
656     92 99 1.000
657     92 100 1.000
658     92 101 1.000
659     92 102 1.000
660     93 94 1.000
661     93 95 1.000
662     93 98 1.000
663     93 99 1.000
664     93 100 1.000
665     93 103 1.000
666     93 105 1.000
667     93 125 1.000
668     93 143 1.000
669     94 95 1.000
670     94 96 1.000
671     94 98 1.000
672     94 99 1.000
673     94 100 1.000
674     94 143 1.000
675     95 96 1.000
676     95 97 1.000
677     95 98 1.000
678     95 125 1.000
679     95 143 1.000
680     95 170 1.000
681     96 97 1.000
682     96 98 1.000
683     97 98 1.000
684     97 99 1.000
685     98 99 1.000
686     98 100 1.000
687     98 143 1.000
688     98 147 1.000
689     98 150 1.000
690     98 151 1.000
691     98 170 1.000
692     99 100 1.000
693     99 101 1.000
694     99 150 1.000
695     100 101 1.000
696     100 102 1.000
697     100 103 1.000
698     100 143 1.000
699     100 146 1.000
700     100 147 1.000
701     101 102 1.000
702     101 103 1.000
703     102 103 1.000
704     102 104 1.000
705     102 146 1.000
706     103 104 1.000
707     103 105 1.000
708     103 141 1.000
709     103 142 1.000
710     103 143 1.000
711     103 146 1.000
712     104 105 1.000
713     104 106 1.000
714     104 140 1.000
715     104 141 1.000
716     104 146 1.000
717     105 106 1.000
718     105 107 1.000
719     106 107 1.000
720     106 108 1.000
721     106 133 1.000
722     106 134 1.000
723     106 135 1.000
724     107 108 1.000
725     107 109 1.000
726     108 109 1.000
727     108 110 1.000
728     108 111 1.000
729     109 110 1.000
730     109 111 1.000
731     110 111 1.000
732     110 112 1.000
733     111 112 1.000
734     111 113 1.000
735     111 115 1.000
736     111 116 1.000
737     112 113 1.000
738     112 114 1.000
739     112 115 1.000
740     112 116 1.000
741     113 114 1.000
742     113 115 1.000
743     113 116 1.000
744     113 117 1.000
745     114 115 1.000
746     114 116 1.000
747     114 117 1.000
748     114 118 1.000
749     115 116 1.000
750     115 117 1.000
751     115 118 1.000
752     115 119 1.000
753     115 121 1.000
754     115 124 1.000
755     116 117 1.000
756     116 118 1.000
757     116 119 1.000
758     117 118 1.000
759     117 119 1.000
760     118 119 1.000
761     118 120 1.000
762     118 121 1.000
763     119 120 1.000
764     119 121 1.000
765     119 122 1.000
766     120 121 1.000
767     120 122 1.000
768     121 122 1.000
769     121 123 1.000
770     121 124 1.000
771     122 123 1.000
772     122 124 1.000
773     123 124 1.000
774     123 125 1.000
775     124 125 1.000
776     124 126 1.000
777     125 126 1.000
778     125 127 1.000
779     125 143 1.000
780     126 127 1.000
781     126 128 1.000
782     126 142 1.000
783     126 143 1.000
784     127 128 1.000
785     127 129 1.000
786     127 142 1.000
787     127 143 1.000
788     127 144 1.000
789     127 156 1.000
790     127 168 1.000
791     127 170 1.000
792     127 194 1.000
793     128 129 1.000
794     128 130 1.000
795     128 132 1.000
796     128 142 1.000
797     128 192 1.000
798     128 193 1.000
799     128 194 1.000
800     129 130 1.000
801     129 131 1.000
802     129 132 1.000
803     129 133 1.000
804     129 142 1.000
805     129 187 1.000
806     129 189 1.000
807     129 192 1.000
808     129 193 1.000
809     129 194 1.000
810     129 322 1.000
811     130 131 1.000
812     130 132 1.000
813     130 133 1.000
814     130 139 1.000
815     130 140 1.000
816     130 141 1.000
817     130 142 1.000
818     130 145 1.000
819     131 132 1.000
820     131 133 1.000
821     131 139 1.000
822     131 189 1.000
823     131 192 1.000
824     132 133 1.000
825     132 134 1.000
826     132 139 1.000
827     132 191 1.000
828     132 192 1.000
829     132 193 1.000
830     133 134 1.000
831     133 135 1.000
832     133 139 1.000
833     133 140 1.000
834     134 135 1.000
835     134 136 1.000
836     135 136 1.000
837     135 137 1.000
838     135 138 1.000
839     135 139 1.000
840     135 140 1.000
841     136 137 1.000
842     136 138 1.000
843     137 138 1.000
844     137 139 1.000
845     138 139 1.000
846     138 140 1.000
847     139 140 1.000
848     139 141 1.000
849     140 141 1.000
850     140 142 1.000
851     141 142 1.000
852     141 143 1.000
853     141 145 1.000
854     141 146 1.000
855     142 143 1.000
856     142 144 1.000
857     142 145 1.000
858     142 146 1.000
859     142 147 1.000
860     143 144 1.000
861     143 145 1.000
862     143 146 1.000
863     143 147 1.000
864     143 170 1.000
865     144 145 1.000
866     144 146 1.000
867     144 147 1.000
868     144 148 1.000
869     144 151 1.000
870     144 154 1.000
871     144 155 1.000
872     144 156 1.000
873     144 170 1.000
874     144 194 1.000
875     144 316 1.000
876     144 318 1.000
877     145 146 1.000
878     145 147 1.000
879     145 148 1.000
880     145 149 1.000
881     146 147 1.000
882     146 148 1.000
883     146 149 1.000
884     147 148 1.000
885     147 149 1.000
886     147 150 1.000
887     147 151 1.000
888     148 149 1.000
889     148 150 1.000
890     148 151 1.000
891     148 154 1.000
892     148 318 1.000
893     149 150 1.000
894     149 151 1.000
895     150 151 1.000
896     150 152 1.000
897     151 152 1.000
898     151 153 1.000
899     151 154 1.000
900     151 155 1.000
901     151 170 1.000
902     151 171 1.000
903     152 153 1.000
904     152 154 1.000
905     152 171 1.000
906     153 154 1.000
907     153 155 1.000
908     153 171 1.000
909     153 172 1.000
910     154 155 1.000
911     154 156 1.000
912     154 316 1.000
913     154 317 1.000
914     154 318 1.000
915     154 319 1.000
916     155 156 1.000
917     155 157 1.000
918     155 169 1.000
919     155 170 1.000
920     155 171 1.000
921     155 172 1.000
922     155 173 1.000
923     155 315 1.000
924     155 316 1.000
925     155 317 1.000
926     155 318 1.000
927     156 157 1.000
928     156 158 1.000
929     156 168 1.000
930     156 169 1.000
931     156 170 1.000
932     156 171 1.000
933     156 194 1.000
934     156 314 1.000
935     156 315 1.000
936     156 316 1.000
937     156 317 1.000
938     157 158 1.000
939     157 159 1.000
940     157 167 1.000
941     157 168 1.000
942     157 169 1.000
943     157 172 1.000
944     157 173 1.000
945     157 313 1.000
946     157 314 1.000
947     157 315 1.000
948     157 316 1.000
949     158 159 1.000
950     158 160 1.000
951     158 167 1.000
952     158 168 1.000
953     158 219 1.000
954     158 312 1.000
955     158 313 1.000
956     158 314 1.000
957     158 316 1.000
958     159 160 1.000
959     159 161 1.000
960     159 166 1.000
961     159 167 1.000
962     159 177 1.000
963     159 312 1.000
964     159 313 1.000
965     159 329 1.000
966     160 161 1.000
967     160 162 1.000
968     160 166 1.000
969     160 167 1.000
970     160 168 1.000
971     160 219 1.000
972     160 306 1.000
973     160 309 1.000
974     160 310 1.000
975     160 312 1.000
976     160 329 1.000
977     161 162 1.000
978     161 163 1.000
979     161 164 1.000
980     161 165 1.000
981     161 166 1.000
982     161 310 1.000
983     161 329 1.000
984     162 163 1.000
985     162 164 1.000
986     162 275 1.000
987     162 276 1.000
988     162 310 1.000
989     163 164 1.000
990     163 165 1.000
991     163 279 1.000
992     164 165 1.000
993     164 166 1.000
994     165 166 1.000
995     165 167 1.000
996     166 167 1.000
997     166 168 1.000
998     167 168 1.000
999     167 169 1.000
1000     168 169 1.000
1001     168 170 1.000
1002     168 219 1.000
1003     169 170 1.000
1004     169 171 1.000
1005     169 172 1.000
1006     169 174 1.000
1007     170 171 1.000
1008     170 172 1.000
1009     171 172 1.000
1010     171 173 1.000
1011     172 173 1.000
1012     172 174 1.000
1013     173 174 1.000
1014     173 175 1.000
1015     173 178 1.000
1016     173 182 1.000
1017     173 184 1.000
1018     173 313 1.000
1019     173 315 1.000
1020     174 175 1.000
1021     174 176 1.000
1022     174 177 1.000
1023     174 178 1.000
1024     174 313 1.000
1025     175 176 1.000
1026     175 177 1.000
1027     175 178 1.000
1028     176 177 1.000
1029     176 178 1.000
1030     177 178 1.000
1031     177 179 1.000
1032     177 313 1.000
1033     177 329 1.000
1034     178 179 1.000
1035     178 180 1.000
1036     178 181 1.000
1037     178 182 1.000
1038     178 313 1.000
1039     178 327 1.000
1040     178 328 1.000
1041     178 329 1.000
1042     179 180 1.000
1043     179 181 1.000
1044     179 327 1.000
1045     179 328 1.000
1046     179 329 1.000
1047     180 181 1.000
1048     180 182 1.000
1049     181 182 1.000
1050     181 183 1.000
1051     181 326 1.000
1052     181 327 1.000
1053     182 183 1.000
1054     182 184 1.000
1055     182 313 1.000
1056     182 315 1.000
1057     182 325 1.000
1058     182 326 1.000
1059     182 327 1.000
1060     183 184 1.000
1061     183 185 1.000
1062     183 265 1.000
1063     183 266 1.000
1064     183 268 1.000
1065     183 324 1.000
1066     183 325 1.000
1067     183 326 1.000
1068     183 327 1.000
1069     184 185 1.000
1070     184 186 1.000
1071     184 265 1.000
1072     184 315 1.000
1073     184 317 1.000
1074     184 323 1.000
1075     184 324 1.000
1076     184 325 1.000
1077     184 326 1.000
1078     185 186 1.000
1079     185 187 1.000
1080     185 196 1.000
1081     185 197 1.000
1082     185 265 1.000
1083     185 266 1.000
1084     185 323 1.000
1085     185 324 1.000
1086     185 325 1.000
1087     185 326 1.000
1088     186 187 1.000
1089     186 188 1.000
1090     186 195 1.000
1091     186 196 1.000
1092     186 197 1.000
1093     186 322 1.000
1094     186 323 1.000
1095     187 188 1.000
1096     187 189 1.000
1097     187 193 1.000
1098     187 194 1.000
1099     187 195 1.000
1100     187 196 1.000
1101     187 322 1.000
1102     187 323 1.000
1103     187 324 1.000
1104     188 189 1.000
1105     188 190 1.000
1106     188 191 1.000
1107     188 193 1.000
1108     188 194 1.000
1109     188 195 1.000
1110     188 196 1.000
1111     189 190 1.000
1112     189 191 1.000
1113     189 192 1.000
1114     189 193 1.000
1115     189 322 1.000
1116     190 191 1.000
1117     190 192 1.000
1118     191 192 1.000
1119     191 193 1.000
1120     191 195 1.000
1121     192 193 1.000
1122     192 194 1.000
1123     193 194 1.000
1124     193 195 1.000
1125     193 216 1.000
1126     193 301 1.000
1127     194 195 1.000
1128     194 196 1.000
1129     194 215 1.000
1130     194 216 1.000
1131     194 217 1.000
1132     194 316 1.000
1133     194 317 1.000
1134     194 318 1.000
1135     194 322 1.000
1136     194 323 1.000
1137     194 324 1.000
1138     195 196 1.000
1139     195 197 1.000
1140     195 214 1.000
1141     195 215 1.000
1142     195 216 1.000
1143     196 197 1.000
1144     196 198 1.000
1145     196 213 1.000
1146     196 214 1.000
1147     196 215 1.000
1148     196 216 1.000
1149     196 217 1.000
1150     196 263 1.000
1151     196 264 1.000
1152     196 265 1.000
1153     196 304 1.000
1154     196 324 1.000
1155     196 326 1.000
1156     197 198 1.000
1157     197 199 1.000
1158     197 212 1.000
1159     197 213 1.000
1160     197 214 1.000
1161     197 215 1.000
1162     198 199 1.000
1163     198 200 1.000
1164     198 211 1.000
1165     198 212 1.000
1166     198 213 1.000
1167     198 214 1.000
1168     198 263 1.000
1169     198 264 1.000
1170     198 265 1.000
1171     198 304 1.000
1172     199 200 1.000
1173     199 201 1.000
1174     199 208 1.000
1175     199 209 1.000
1176     199 210 1.000
1177     199 211 1.000
1178     199 212 1.000
1179     199 264 1.000
1180     199 265 1.000
1181     199 266 1.000
1182     199 268 1.000
1183     199 269 1.000
1184     200 201 1.000
1185     200 202 1.000
1186     200 208 1.000
1187     200 209 1.000
1188     200 210 1.000
1189     200 211 1.000
1190     200 213 1.000
1191     200 262 1.000
1192     200 263 1.000
1193     200 264 1.000
1194     201 202 1.000
1195     201 203 1.000
1196     201 207 1.000
1197     201 208 1.000
1198     201 209 1.000
1199     201 211 1.000
1200     201 213 1.000
1201     201 229 1.000
1202     201 230 1.000
1203     201 233 1.000
1204     201 261 1.000
1205     201 262 1.000
1206     201 263 1.000
1207     201 264 1.000
1208     202 203 1.000
1209     202 204 1.000
1210     202 206 1.000
1211     202 207 1.000
1212     202 208 1.000
1213     202 209 1.000
1214     202 260 1.000
1215     202 261 1.000
1216     202 262 1.000
1217     203 204 1.000
1218     203 205 1.000
1219     203 206 1.000
1220     203 207 1.000
1221     203 233 1.000
1222     203 234 1.000
1223     203 237 1.000
1224     203 259 1.000
1225     203 260 1.000
1226     203 261 1.000
1227     204 205 1.000
1228     204 206 1.000
1229     204 259 1.000
1230     204 260 1.000
1231     204 261 1.000
1232     204 262 1.000
1233     205 206 1.000
1234     205 207 1.000
1235     206 207 1.000
1236     206 208 1.000
1237     207 208 1.000
1238     207 209 1.000
1239     208 209 1.000
1240     208 210 1.000
1241     208 262 1.000
1242     208 263 1.000
1243     208 264 1.000
1244     208 269 1.000
1245     209 210 1.000
1246     209 211 1.000
1247     210 211 1.000
1248     210 212 1.000
1249     211 212 1.000
1250     211 213 1.000
1251     212 213 1.000
1252     212 214 1.000
1253     213 214 1.000
1254     213 215 1.000
1255     213 226 1.000
1256     213 227 1.000
1257     213 230 1.000
1258     213 302 1.000
1259     213 304 1.000
1260     214 215 1.000
1261     214 216 1.000
1262     214 302 1.000
1263     215 216 1.000
1264     215 217 1.000
1265     215 301 1.000
1266     215 302 1.000
1267     215 303 1.000
1268     215 304 1.000
1269     216 217 1.000
1270     216 218 1.000
1271     216 301 1.000
1272     216 302 1.000
1273     216 303 1.000
1274     216 304 1.000
1275     216 305 1.000
1276     217 218 1.000
1277     217 219 1.000
1278     217 304 1.000
1279     217 309 1.000
1280     217 316 1.000
1281     217 324 1.000
1282     217 326 1.000
1283     218 219 1.000
1284     218 220 1.000
1285     218 221 1.000
1286     218 303 1.000
1287     218 304 1.000
1288     218 305 1.000
1289     218 306 1.000
1290     218 309 1.000
1291     219 220 1.000
1292     219 221 1.000
1293     219 306 1.000
1294     219 309 1.000
1295     219 316 1.000
1296     220 221 1.000
1297     220 222 1.000
1298     220 306 1.000
1299     221 222 1.000
1300     221 223 1.000
1301     221 225 1.000
1302     221 303 1.000
1303     221 305 1.000
1304     221 306 1.000
1305     222 223 1.000
1306     222 224 1.000
1307     222 279 1.000
1308     222 305 1.000
1309     222 306 1.000
1310     222 307 1.000
1311     223 224 1.000
1312     223 225 1.000
1313     223 279 1.000
1314     223 290 1.000
1315     223 291 1.000
1316     223 292 1.000
1317     223 294 1.000
1318     223 303 1.000
1319     223 304 1.000
1320     223 305 1.000
1321     223 306 1.000
1322     223 307 1.000
1323     224 225 1.000
1324     224 226 1.000
1325     224 261 1.000
1326     224 272 1.000
1327     224 292 1.000
1328     224 293 1.000
1329     224 294 1.000
1330     224 303 1.000
1331     224 304 1.000
1332     224 305 1.000
1333     224 307 1.000
1334     224 308 1.000
1335     225 226 1.000
1336     225 227 1.000
1337     225 294 1.000
1338     225 295 1.000
1339     225 296 1.000
1340     225 299 1.000
1341     225 301 1.000
1342     225 302 1.000
1343     225 303 1.000
1344     225 304 1.000
1345     226 227 1.000
1346     226 228 1.000
1347     226 230 1.000
1348     226 231 1.000
1349     226 261 1.000
1350     226 293 1.000
1351     226 294 1.000
1352     226 295 1.000
1353     226 296 1.000
1354     226 297 1.000
1355     226 302 1.000
1356     226 304 1.000
1357     227 228 1.000
1358     227 229 1.000
1359     227 230 1.000
1360     227 231 1.000
1361     227 232 1.000
1362     227 295 1.000
1363     227 296 1.000
1364     227 302 1.000
1365     228 229 1.000
1366     228 230 1.000
1367     228 231 1.000
1368     228 232 1.000
1369     228 233 1.000
1370     228 250 1.000
1371     228 295 1.000
1372     229 230 1.000
1373     229 231 1.000
1374     229 232 1.000
1375     229 233 1.000
1376     230 231 1.000
1377     230 232 1.000
1378     230 233 1.000
1379     230 234 1.000
1380     230 261 1.000
1381     231 232 1.000
1382     231 233 1.000
1383     231 234 1.000
1384     231 235 1.000
1385     231 236 1.000
1386     231 250 1.000
1387     231 293 1.000
1388     231 294 1.000
1389     231 295 1.000
1390     232 233 1.000
1391     232 234 1.000
1392     232 235 1.000
1393     232 236 1.000
1394     232 250 1.000
1395     233 234 1.000
1396     233 235 1.000
1397     233 236 1.000
1398     233 237 1.000
1399     234 235 1.000
1400     234 236 1.000
1401     234 237 1.000
1402     234 238 1.000
1403     234 258 1.000
1404     234 259 1.000
1405     234 260 1.000
1406     234 261 1.000
1407     234 274 1.000
1408     234 277 1.000
1409     234 293 1.000
1410     235 236 1.000
1411     235 237 1.000
1412     235 238 1.000
1413     235 241 1.000
1414     235 250 1.000
1415     235 252 1.000
1416     235 258 1.000
1417     235 277 1.000
1418     235 291 1.000
1419     235 292 1.000
1420     235 293 1.000
1421     235 294 1.000
1422     236 237 1.000
1423     236 238 1.000
1424     237 238 1.000
1425     237 239 1.000
1426     237 259 1.000
1427     238 239 1.000
1428     238 240 1.000
1429     238 241 1.000
1430     238 252 1.000
1431     238 256 1.000
1432     238 258 1.000
1433     238 259 1.000
1434     239 240 1.000
1435     239 241 1.000
1436     240 241 1.000
1437     240 242 1.000
1438     240 251 1.000
1439     240 252 1.000
1440     240 253 1.000
1441     241 242 1.000
1442     241 243 1.000
1443     241 251 1.000
1444     241 252 1.000
1445     241 253 1.000
1446     242 243 1.000
1447     242 244 1.000
1448     242 249 1.000
1449     242 250 1.000
1450     242 251 1.000
1451     243 244 1.000
1452     243 245 1.000
1453     243 249 1.000
1454     243 250 1.000
1455     243 251 1.000
1456     244 245 1.000
1457     244 246 1.000
1458     244 247 1.000
1459     244 248 1.000
1460     244 249 1.000
1461     244 250 1.000
1462     244 251 1.000
1463     245 246 1.000
1464     245 247 1.000
1465     245 248 1.000
1466     246 247 1.000
1467     246 248 1.000
1468     247 248 1.000
1469     247 249 1.000
1470     247 251 1.000
1471     247 282 1.000
1472     247 290 1.000
1473     248 249 1.000
1474     248 250 1.000
1475     248 290 1.000
1476     248 294 1.000
1477     249 250 1.000
1478     249 251 1.000
1479     249 290 1.000
1480     249 294 1.000
1481     250 251 1.000
1482     250 252 1.000
1483     250 289 1.000
1484     250 290 1.000
1485     250 291 1.000
1486     250 293 1.000
1487     250 294 1.000
1488     251 252 1.000
1489     251 253 1.000
1490     251 282 1.000
1491     251 289 1.000
1492     251 290 1.000
1493     251 291 1.000
1494     252 253 1.000
1495     252 254 1.000
1496     252 256 1.000
1497     252 258 1.000
1498     252 277 1.000
1499     252 278 1.000
1500     252 287 1.000
1501     252 288 1.000
1502     252 289 1.000
1503     252 290 1.000
1504     252 291 1.000
1505     253 254 1.000
1506     253 255 1.000
1507     253 256 1.000
1508     253 287 1.000
1509     253 288 1.000
1510     253 289 1.000
1511     254 255 1.000
1512     254 256 1.000
1513     254 278 1.000
1514     254 281 1.000
1515     254 286 1.000
1516     254 287 1.000
1517     254 288 1.000
1518     254 289 1.000
1519     255 256 1.000
1520     255 257 1.000
1521     255 287 1.000
1522     256 257 1.000
1523     256 258 1.000
1524     257 258 1.000
1525     257 259 1.000
1526     258 259 1.000
1527     258 260 1.000
1528     258 274 1.000
1529     258 275 1.000
1530     258 277 1.000
1531     258 278 1.000
1532     259 260 1.000
1533     259 261 1.000
1534     259 272 1.000
1535     259 273 1.000
1536     259 274 1.000
1537     259 277 1.000
1538     260 261 1.000
1539     260 262 1.000
1540     260 271 1.000
1541     260 272 1.000
1542     260 273 1.000
1543     260 274 1.000
1544     260 277 1.000
1545     261 262 1.000
1546     261 263 1.000
1547     261 270 1.000
1548     261 271 1.000
1549     261 272 1.000
1550     261 277 1.000
1551     261 293 1.000
1552     262 263 1.000
1553     262 264 1.000
1554     262 269 1.000
1555     262 270 1.000
1556     262 271 1.000
1557     262 272 1.000
1558     263 264 1.000
1559     263 265 1.000
1560     263 268 1.000
1561     263 269 1.000
1562     263 270 1.000
1563     263 272 1.000
1564     263 304 1.000
1565     263 308 1.000
1566     263 326 1.000
1567     264 265 1.000
1568     264 266 1.000
1569     264 268 1.000
1570     264 269 1.000
1571     265 266 1.000
1572     265 267 1.000
1573     265 268 1.000
1574     265 269 1.000
1575     265 270 1.000
1576     265 326 1.000
1577     266 267 1.000
1578     266 268 1.000
1579     266 269 1.000
1580     267 268 1.000
1581     267 269 1.000
1582     268 269 1.000
1583     268 270 1.000
1584     269 270 1.000
1585     269 271 1.000
1586     269 328 1.000
1587     270 271 1.000
1588     270 272 1.000
1589     270 308 1.000
1590     270 311 1.000
1591     270 312 1.000
1592     270 326 1.000
1593     270 327 1.000
1594     270 328 1.000
1595     271 272 1.000
1596     271 273 1.000
1597     271 311 1.000
1598     272 273 1.000
1599     272 274 1.000
1600     272 276 1.000
1601     272 277 1.000
1602     272 307 1.000
1603     272 308 1.000
1604     272 311 1.000
1605     273 274 1.000
1606     273 275 1.000
1607     273 276 1.000
1608     273 277 1.000
1609     273 311 1.000
1610     274 275 1.000
1611     274 276 1.000
1612     274 277 1.000
1613     274 278 1.000
1614     275 276 1.000
1615     275 277 1.000
1616     275 278 1.000
1617     276 277 1.000
1618     276 278 1.000
1619     276 279 1.000
1620     276 292 1.000
1621     276 307 1.000
1622     276 310 1.000
1623     276 311 1.000
1624     277 278 1.000
1625     277 279 1.000
1626     277 290 1.000
1627     277 291 1.000
1628     277 292 1.000
1629     277 293 1.000
1630     277 307 1.000
1631     278 279 1.000
1632     278 280 1.000
1633     278 281 1.000
1634     278 289 1.000
1635     278 290 1.000
1636     278 292 1.000
1637     279 280 1.000
1638     279 281 1.000
1639     279 290 1.000
1640     279 291 1.000
1641     279 292 1.000
1642     280 281 1.000
1643     280 282 1.000
1644     280 288 1.000
1645     280 289 1.000
1646     280 290 1.000
1647     281 282 1.000
1648     281 283 1.000
1649     281 284 1.000
1650     281 285 1.000
1651     281 286 1.000
1652     281 288 1.000
1653     281 289 1.000
1654     281 290 1.000
1655     282 283 1.000
1656     282 284 1.000
1657     282 286 1.000
1658     282 288 1.000
1659     282 289 1.000
1660     282 290 1.000
1661     283 284 1.000
1662     283 285 1.000
1663     283 286 1.000
1664     283 288 1.000
1665     284 285 1.000
1666     284 286 1.000
1667     285 286 1.000
1668     285 287 1.000
1669     286 287 1.000
1670     286 288 1.000
1671     287 288 1.000
1672     287 289 1.000
1673     288 289 1.000
1674     288 290 1.000
1675     289 290 1.000
1676     289 291 1.000
1677     290 291 1.000
1678     290 292 1.000
1679     290 294 1.000
1680     291 292 1.000
1681     291 293 1.000
1682     291 294 1.000
1683     292 293 1.000
1684     292 294 1.000
1685     292 307 1.000
1686     293 294 1.000
1687     293 295 1.000
1688     293 307 1.000
1689     294 295 1.000
1690     294 296 1.000
1691     295 296 1.000
1692     295 297 1.000
1693     295 298 1.000
1694     296 297 1.000
1695     296 298 1.000
1696     296 299 1.000
1697     296 300 1.000
1698     296 301 1.000
1699     296 302 1.000
1700     297 298 1.000
1701     297 299 1.000
1702     297 300 1.000
1703     298 299 1.000
1704     298 300 1.000
1705     299 300 1.000
1706     299 301 1.000
1707     299 303 1.000
1708     300 301 1.000
1709     300 302 1.000
1710     301 302 1.000
1711     301 303 1.000
1712     302 303 1.000
1713     302 304 1.000
1714     303 304 1.000
1715     303 305 1.000
1716     304 305 1.000
1717     304 306 1.000
1718     304 308 1.000
1719     304 309 1.000
1720     305 306 1.000
1721     305 307 1.000
1722     305 308 1.000
1723     305 309 1.000
1724     305 310 1.000
1725     306 307 1.000
1726     306 308 1.000
1727     306 309 1.000
1728     306 310 1.000
1729     306 311 1.000
1730     307 308 1.000
1731     307 309 1.000
1732     307 310 1.000
1733     307 311 1.000
1734     308 309 1.000
1735     308 310 1.000
1736     308 311 1.000
1737     308 312 1.000
1738     309 310 1.000
1739     309 311 1.000
1740     309 312 1.000
1741     309 313 1.000
1742     309 314 1.000
1743     309 316 1.000
1744     309 326 1.000
1745     309 329 1.000
1746     310 311 1.000
1747     310 312 1.000
1748     310 329 1.000
1749     311 312 1.000
1750     311 313 1.000
1751     311 327 1.000
1752     311 328 1.000
1753     311 329 1.000
1754     312 313 1.000
1755     312 314 1.000
1756     312 326 1.000
1757     312 327 1.000
1758     312 329 1.000
1759     313 314 1.000
1760     313 315 1.000
1761     313 325 1.000
1762     313 326 1.000
1763     313 327 1.000
1764     313 328 1.000
1765     313 329 1.000
1766     314 315 1.000
1767     314 316 1.000
1768     314 324 1.000
1769     314 325 1.000
1770     314 326 1.000
1771     315 316 1.000
1772     315 317 1.000
1773     315 323 1.000
1774     315 324 1.000
1775     315 325 1.000
1776     315 326 1.000
1777     316 317 1.000
1778     316 318 1.000
1779     316 323 1.000
1780     316 324 1.000
1781     317 318 1.000
1782     317 319 1.000
1783     317 321 1.000
1784     317 322 1.000
1785     317 323 1.000
1786     317 324 1.000
1787     318 319 1.000
1788     318 320 1.000
1789     318 322 1.000
1790     319 320 1.000
1791     319 321 1.000
1792     319 322 1.000
1793     320 321 1.000
1794     320 322 1.000
1795     321 322 1.000
1796     321 323 1.000
1797     322 323 1.000
1798     322 324 1.000
1799     323 324 1.000
1800     323 325 1.000
1801     324 325 1.000
1802     324 326 1.000
1803     325 326 1.000
1804     325 327 1.000
1805     326 327 1.000
1806     326 328 1.000
1807     327 328 1.000
1808     327 329 1.000
1809     328 329 1.000