ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1oewA_Cb_8.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 3 months ago) by hstehr
File size: 24771 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3     #PDB: 1oew
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: Cb
8     #CUTOFF: 8.0
9     1 2 1.000
10     1 3 1.000
11     1 98 1.000
12     1 99 1.000
13     1 147 1.000
14     1 150 1.000
15     1 151 1.000
16     1 152 1.000
17     1 171 1.000
18     2 3 1.000
19     2 4 1.000
20     2 97 1.000
21     2 98 1.000
22     2 151 1.000
23     2 152 1.000
24     2 169 1.000
25     2 170 1.000
26     2 171 1.000
27     2 172 1.000
28     3 4 1.000
29     3 5 1.000
30     3 95 1.000
31     3 96 1.000
32     3 97 1.000
33     3 98 1.000
34     3 169 1.000
35     3 170 1.000
36     3 171 1.000
37     4 5 1.000
38     4 96 1.000
39     4 97 1.000
40     4 167 1.000
41     4 168 1.000
42     4 169 1.000
43     4 170 1.000
44     5 6 1.000
45     5 7 1.000
46     5 19 1.000
47     5 20 1.000
48     5 95 1.000
49     5 96 1.000
50     5 97 1.000
51     5 167 1.000
52     5 168 1.000
53     6 7 1.000
54     6 8 1.000
55     6 19 1.000
56     6 20 1.000
57     6 165 1.000
58     6 166 1.000
59     6 167 1.000
60     7 8 1.000
61     7 17 1.000
62     7 18 1.000
63     7 19 1.000
64     7 34 1.000
65     7 160 1.000
66     7 165 1.000
67     7 166 1.000
68     7 167 1.000
69     7 168 1.000
70     8 9 1.000
71     8 10 1.000
72     8 17 1.000
73     8 18 1.000
74     8 19 1.000
75     8 165 1.000
76     8 166 1.000
77     9 10 1.000
78     9 11 1.000
79     9 12 1.000
80     9 13 1.000
81     9 14 1.000
82     9 15 1.000
83     9 16 1.000
84     9 17 1.000
85     9 161 1.000
86     9 163 1.000
87     9 164 1.000
88     9 165 1.000
89     10 11 1.000
90     10 15 1.000
91     10 16 1.000
92     10 17 1.000
93     10 18 1.000
94     10 118 1.000
95     10 120 1.000
96     10 121 1.000
97     11 12 1.000
98     11 13 1.000
99     11 14 1.000
100     11 15 1.000
101     11 16 1.000
102     11 120 1.000
103     12 13 1.000
104     12 163 1.000
105     13 14 1.000
106     13 15 1.000
107     13 222 1.000
108     13 279 1.000
109     13 280 1.000
110     14 15 1.000
111     14 16 1.000
112     14 17 1.000
113     14 160 1.000
114     14 161 1.000
115     14 162 1.000
116     14 163 1.000
117     14 222 1.000
118     14 306 1.000
119     14 310 1.000
120     15 16 1.000
121     15 222 1.000
122     16 17 1.000
123     16 18 1.000
124     16 33 1.000
125     16 120 1.000
126     16 121 1.000
127     16 220 1.000
128     16 222 1.000
129     16 306 1.000
130     17 18 1.000
131     17 19 1.000
132     17 33 1.000
133     17 34 1.000
134     17 160 1.000
135     17 166 1.000
136     17 219 1.000
137     17 306 1.000
138     18 19 1.000
139     18 20 1.000
140     18 31 1.000
141     18 32 1.000
142     18 33 1.000
143     18 120 1.000
144     18 121 1.000
145     18 122 1.000
146     19 20 1.000
147     19 21 1.000
148     19 31 1.000
149     19 32 1.000
150     19 33 1.000
151     19 34 1.000
152     19 95 1.000
153     19 125 1.000
154     19 168 1.000
155     20 21 1.000
156     20 22 1.000
157     20 29 1.000
158     20 30 1.000
159     20 31 1.000
160     20 32 1.000
161     20 95 1.000
162     20 96 1.000
163     21 22 1.000
164     21 23 1.000
165     21 29 1.000
166     21 30 1.000
167     21 31 1.000
168     21 32 1.000
169     21 93 1.000
170     21 94 1.000
171     21 95 1.000
172     21 125 1.000
173     22 23 1.000
174     22 24 1.000
175     22 27 1.000
176     22 28 1.000
177     22 29 1.000
178     22 93 1.000
179     22 94 1.000
180     22 95 1.000
181     22 97 1.000
182     23 24 1.000
183     23 27 1.000
184     23 28 1.000
185     23 29 1.000
186     23 30 1.000
187     23 43 1.000
188     23 58 1.000
189     23 63 1.000
190     23 91 1.000
191     23 92 1.000
192     23 93 1.000
193     23 105 1.000
194     24 25 1.000
195     24 26 1.000
196     24 27 1.000
197     24 28 1.000
198     24 63 1.000
199     24 64 1.000
200     24 65 1.000
201     24 66 1.000
202     24 91 1.000
203     24 92 1.000
204     24 93 1.000
205     25 26 1.000
206     25 27 1.000
207     25 63 1.000
208     25 64 1.000
209     25 65 1.000
210     25 91 1.000
211     25 92 1.000
212     26 27 1.000
213     26 28 1.000
214     26 62 1.000
215     26 63 1.000
216     27 28 1.000
217     27 29 1.000
218     27 94 1.000
219     28 29 1.000
220     28 30 1.000
221     28 56 1.000
222     28 58 1.000
223     28 59 1.000
224     28 62 1.000
225     28 63 1.000
226     29 30 1.000
227     29 31 1.000
228     29 56 1.000
229     30 31 1.000
230     30 32 1.000
231     30 43 1.000
232     30 44 1.000
233     30 56 1.000
234     30 57 1.000
235     30 58 1.000
236     30 122 1.000
237     30 123 1.000
238     31 32 1.000
239     31 56 1.000
240     31 120 1.000
241     31 121 1.000
242     31 122 1.000
243     32 33 1.000
244     32 34 1.000
245     32 41 1.000
246     32 43 1.000
247     32 121 1.000
248     32 122 1.000
249     32 123 1.000
250     32 124 1.000
251     32 125 1.000
252     33 34 1.000
253     33 35 1.000
254     33 121 1.000
255     33 123 1.000
256     33 124 1.000
257     33 125 1.000
258     33 220 1.000
259     34 35 1.000
260     34 36 1.000
261     34 124 1.000
262     34 125 1.000
263     34 126 1.000
264     34 127 1.000
265     34 158 1.000
266     34 168 1.000
267     34 219 1.000
268     34 220 1.000
269     35 36 1.000
270     35 37 1.000
271     35 38 1.000
272     35 124 1.000
273     35 125 1.000
274     35 126 1.000
275     35 127 1.000
276     35 128 1.000
277     35 218 1.000
278     35 219 1.000
279     35 220 1.000
280     36 37 1.000
281     36 126 1.000
282     36 127 1.000
283     36 128 1.000
284     36 158 1.000
285     36 194 1.000
286     36 217 1.000
287     36 218 1.000
288     36 219 1.000
289     36 220 1.000
290     36 316 1.000
291     37 38 1.000
292     37 39 1.000
293     37 126 1.000
294     37 127 1.000
295     37 128 1.000
296     37 132 1.000
297     37 193 1.000
298     37 194 1.000
299     37 216 1.000
300     37 218 1.000
301     37 219 1.000
302     37 220 1.000
303     37 221 1.000
304     38 39 1.000
305     38 40 1.000
306     38 76 1.000
307     38 78 1.000
308     38 124 1.000
309     38 126 1.000
310     38 128 1.000
311     38 132 1.000
312     38 220 1.000
313     39 40 1.000
314     39 126 1.000
315     39 127 1.000
316     39 128 1.000
317     39 129 1.000
318     39 130 1.000
319     39 131 1.000
320     39 132 1.000
321     39 133 1.000
322     39 134 1.000
323     39 142 1.000
324     39 192 1.000
325     40 41 1.000
326     40 42 1.000
327     40 74 1.000
328     40 76 1.000
329     40 106 1.000
330     40 124 1.000
331     40 126 1.000
332     40 133 1.000
333     40 134 1.000
334     40 135 1.000
335     40 140 1.000
336     41 42 1.000
337     41 43 1.000
338     41 93 1.000
339     41 103 1.000
340     41 104 1.000
341     41 105 1.000
342     41 106 1.000
343     41 124 1.000
344     41 125 1.000
345     41 126 1.000
346     41 142 1.000
347     41 143 1.000
348     42 43 1.000
349     42 74 1.000
350     42 76 1.000
351     42 84 1.000
352     42 86 1.000
353     42 105 1.000
354     42 106 1.000
355     42 107 1.000
356     42 108 1.000
357     42 123 1.000
358     42 124 1.000
359     43 44 1.000
360     43 45 1.000
361     43 57 1.000
362     43 58 1.000
363     43 105 1.000
364     43 106 1.000
365     43 107 1.000
366     43 108 1.000
367     43 122 1.000
368     43 123 1.000
369     44 45 1.000
370     44 48 1.000
371     44 53 1.000
372     44 55 1.000
373     44 56 1.000
374     44 57 1.000
375     44 58 1.000
376     44 108 1.000
377     44 111 1.000
378     44 115 1.000
379     44 122 1.000
380     44 123 1.000
381     45 46 1.000
382     45 47 1.000
383     45 48 1.000
384     45 57 1.000
385     45 58 1.000
386     45 59 1.000
387     45 60 1.000
388     45 107 1.000
389     45 108 1.000
390     46 47 1.000
391     46 48 1.000
392     46 57 1.000
393     46 58 1.000
394     46 59 1.000
395     46 60 1.000
396     46 61 1.000
397     47 48 1.000
398     47 60 1.000
399     47 86 1.000
400     47 87 1.000
401     47 107 1.000
402     47 108 1.000
403     47 109 1.000
404     48 49 1.000
405     48 50 1.000
406     48 52 1.000
407     48 53 1.000
408     48 57 1.000
409     48 107 1.000
410     48 108 1.000
411     48 109 1.000
412     48 110 1.000
413     48 111 1.000
414     49 50 1.000
415     49 51 1.000
416     49 52 1.000
417     49 53 1.000
418     49 109 1.000
419     49 110 1.000
420     49 111 1.000
421     50 51 1.000
422     50 52 1.000
423     50 53 1.000
424     51 52 1.000
425     51 53 1.000
426     52 53 1.000
427     52 110 1.000
428     52 111 1.000
429     52 115 1.000
430     52 116 1.000
431     53 55 1.000
432     53 57 1.000
433     53 111 1.000
434     53 116 1.000
435     55 56 1.000
436     55 57 1.000
437     55 119 1.000
438     55 121 1.000
439     55 122 1.000
440     55 123 1.000
441     56 57 1.000
442     56 122 1.000
443     57 58 1.000
444     57 59 1.000
445     57 122 1.000
446     58 59 1.000
447     58 60 1.000
448     58 105 1.000
449     58 107 1.000
450     58 122 1.000
451     59 60 1.000
452     59 61 1.000
453     59 62 1.000
454     59 63 1.000
455     60 61 1.000
456     60 62 1.000
457     60 63 1.000
458     60 66 1.000
459     60 68 1.000
460     60 89 1.000
461     60 91 1.000
462     60 105 1.000
463     60 107 1.000
464     61 62 1.000
465     61 63 1.000
466     61 66 1.000
467     62 63 1.000
468     63 64 1.000
469     63 65 1.000
470     63 66 1.000
471     63 89 1.000
472     63 91 1.000
473     63 92 1.000
474     64 65 1.000
475     64 66 1.000
476     65 66 1.000
477     65 67 1.000
478     65 91 1.000
479     65 92 1.000
480     65 101 1.000
481     66 67 1.000
482     66 68 1.000
483     66 89 1.000
484     66 90 1.000
485     66 91 1.000
486     66 105 1.000
487     67 68 1.000
488     67 69 1.000
489     67 89 1.000
490     67 90 1.000
491     67 91 1.000
492     67 102 1.000
493     68 69 1.000
494     68 70 1.000
495     68 87 1.000
496     68 88 1.000
497     68 89 1.000
498     69 70 1.000
499     69 71 1.000
500     69 72 1.000
501     69 87 1.000
502     69 88 1.000
503     69 89 1.000
504     69 90 1.000
505     69 104 1.000
506     69 135 1.000
507     69 140 1.000
508     70 71 1.000
509     70 72 1.000
510     71 72 1.000
511     71 73 1.000
512     71 87 1.000
513     71 137 1.000
514     72 73 1.000
515     72 74 1.000
516     72 87 1.000
517     72 88 1.000
518     72 135 1.000
519     72 136 1.000
520     72 137 1.000
521     72 138 1.000
522     72 140 1.000
523     73 74 1.000
524     73 75 1.000
525     73 85 1.000
526     73 86 1.000
527     73 87 1.000
528     73 88 1.000
529     73 135 1.000
530     73 136 1.000
531     74 75 1.000
532     74 76 1.000
533     74 85 1.000
534     74 86 1.000
535     74 87 1.000
536     74 88 1.000
537     74 106 1.000
538     74 134 1.000
539     74 135 1.000
540     74 136 1.000
541     75 76 1.000
542     75 77 1.000
543     75 83 1.000
544     75 84 1.000
545     75 85 1.000
546     75 86 1.000
547     75 134 1.000
548     76 77 1.000
549     76 78 1.000
550     76 83 1.000
551     76 84 1.000
552     76 85 1.000
553     76 134 1.000
554     77 78 1.000
555     77 79 1.000
556     77 81 1.000
557     77 82 1.000
558     77 83 1.000
559     78 79 1.000
560     78 80 1.000
561     78 81 1.000
562     78 82 1.000
563     78 83 1.000
564     79 80 1.000
565     79 81 1.000
566     79 82 1.000
567     79 299 1.000
568     80 81 1.000
569     80 82 1.000
570     80 114 1.000
571     81 82 1.000
572     81 83 1.000
573     81 112 1.000
574     81 114 1.000
575     82 83 1.000
576     82 84 1.000
577     82 112 1.000
578     82 114 1.000
579     82 115 1.000
580     83 84 1.000
581     83 85 1.000
582     83 111 1.000
583     83 112 1.000
584     84 85 1.000
585     84 86 1.000
586     84 108 1.000
587     84 110 1.000
588     84 111 1.000
589     84 112 1.000
590     84 115 1.000
591     85 86 1.000
592     85 108 1.000
593     85 109 1.000
594     85 110 1.000
595     86 87 1.000
596     86 88 1.000
597     86 106 1.000
598     86 107 1.000
599     86 108 1.000
600     86 109 1.000
601     86 110 1.000
602     87 88 1.000
603     87 89 1.000
604     87 106 1.000
605     87 107 1.000
606     87 109 1.000
607     88 89 1.000
608     88 90 1.000
609     88 104 1.000
610     88 105 1.000
611     88 106 1.000
612     88 107 1.000
613     88 135 1.000
614     88 140 1.000
615     89 90 1.000
616     89 91 1.000
617     89 104 1.000
618     89 105 1.000
619     89 106 1.000
620     89 107 1.000
621     90 91 1.000
622     90 102 1.000
623     90 103 1.000
624     90 104 1.000
625     90 105 1.000
626     91 92 1.000
627     91 93 1.000
628     91 102 1.000
629     91 103 1.000
630     91 105 1.000
631     92 93 1.000
632     92 94 1.000
633     92 99 1.000
634     92 100 1.000
635     92 101 1.000
636     92 102 1.000
637     92 103 1.000
638     93 94 1.000
639     93 95 1.000
640     93 99 1.000
641     93 100 1.000
642     93 102 1.000
643     93 103 1.000
644     93 105 1.000
645     93 143 1.000
646     94 95 1.000
647     94 96 1.000
648     94 97 1.000
649     94 98 1.000
650     94 99 1.000
651     94 100 1.000
652     95 96 1.000
653     95 97 1.000
654     95 98 1.000
655     95 125 1.000
656     95 143 1.000
657     95 168 1.000
658     95 170 1.000
659     96 97 1.000
660     96 98 1.000
661     96 170 1.000
662     97 98 1.000
663     97 99 1.000
664     98 99 1.000
665     98 100 1.000
666     98 147 1.000
667     98 150 1.000
668     98 151 1.000
669     98 170 1.000
670     98 171 1.000
671     99 100 1.000
672     99 101 1.000
673     100 101 1.000
674     100 102 1.000
675     100 103 1.000
676     100 143 1.000
677     100 146 1.000
678     100 147 1.000
679     100 150 1.000
680     101 102 1.000
681     101 103 1.000
682     102 103 1.000
683     102 104 1.000
684     102 146 1.000
685     103 104 1.000
686     103 105 1.000
687     103 143 1.000
688     103 146 1.000
689     104 105 1.000
690     104 106 1.000
691     104 133 1.000
692     104 135 1.000
693     104 140 1.000
694     104 141 1.000
695     105 106 1.000
696     105 107 1.000
697     106 107 1.000
698     106 108 1.000
699     106 135 1.000
700     106 140 1.000
701     107 108 1.000
702     107 109 1.000
703     108 109 1.000
704     108 110 1.000
705     108 111 1.000
706     108 123 1.000
707     109 110 1.000
708     110 111 1.000
709     110 112 1.000
710     111 112 1.000
711     111 115 1.000
712     111 116 1.000
713     112 113 1.000
714     112 114 1.000
715     112 115 1.000
716     112 116 1.000
717     113 114 1.000
718     113 115 1.000
719     113 116 1.000
720     113 117 1.000
721     114 115 1.000
722     114 116 1.000
723     114 117 1.000
724     114 118 1.000
725     115 116 1.000
726     115 117 1.000
727     115 118 1.000
728     115 121 1.000
729     115 123 1.000
730     116 117 1.000
731     116 118 1.000
732     117 118 1.000
733     118 119 1.000
734     118 120 1.000
735     118 121 1.000
736     119 120 1.000
737     119 121 1.000
738     120 121 1.000
739     121 122 1.000
740     121 123 1.000
741     121 124 1.000
742     122 123 1.000
743     123 124 1.000
744     123 125 1.000
745     124 125 1.000
746     124 126 1.000
747     125 126 1.000
748     125 127 1.000
749     125 143 1.000
750     126 127 1.000
751     126 128 1.000
752     126 142 1.000
753     126 143 1.000
754     127 128 1.000
755     127 142 1.000
756     127 143 1.000
757     127 144 1.000
758     127 156 1.000
759     127 219 1.000
760     127 316 1.000
761     128 129 1.000
762     128 132 1.000
763     128 142 1.000
764     128 192 1.000
765     128 193 1.000
766     128 194 1.000
767     129 130 1.000
768     129 131 1.000
769     129 132 1.000
770     129 142 1.000
771     129 189 1.000
772     129 192 1.000
773     129 193 1.000
774     129 194 1.000
775     129 322 1.000
776     130 131 1.000
777     130 132 1.000
778     130 133 1.000
779     130 139 1.000
780     130 140 1.000
781     130 141 1.000
782     130 142 1.000
783     130 145 1.000
784     131 132 1.000
785     131 133 1.000
786     131 139 1.000
787     131 189 1.000
788     131 192 1.000
789     132 133 1.000
790     132 134 1.000
791     132 192 1.000
792     132 193 1.000
793     133 134 1.000
794     133 135 1.000
795     133 139 1.000
796     133 140 1.000
797     133 141 1.000
798     133 142 1.000
799     134 135 1.000
800     134 136 1.000
801     134 139 1.000
802     135 136 1.000
803     135 138 1.000
804     135 139 1.000
805     135 140 1.000
806     136 137 1.000
807     136 138 1.000
808     136 139 1.000
809     137 138 1.000
810     138 139 1.000
811     138 140 1.000
812     139 140 1.000
813     139 141 1.000
814     140 141 1.000
815     141 142 1.000
816     141 145 1.000
817     141 146 1.000
818     142 143 1.000
819     142 144 1.000
820     142 145 1.000
821     142 146 1.000
822     143 144 1.000
823     143 145 1.000
824     143 146 1.000
825     143 147 1.000
826     144 145 1.000
827     144 146 1.000
828     144 147 1.000
829     144 148 1.000
830     144 156 1.000
831     144 170 1.000
832     144 316 1.000
833     144 318 1.000
834     145 146 1.000
835     145 147 1.000
836     145 148 1.000
837     146 147 1.000
838     146 148 1.000
839     146 149 1.000
840     147 148 1.000
841     147 149 1.000
842     147 150 1.000
843     147 151 1.000
844     147 170 1.000
845     147 171 1.000
846     148 149 1.000
847     148 150 1.000
848     148 151 1.000
849     148 154 1.000
850     148 318 1.000
851     149 150 1.000
852     149 151 1.000
853     150 151 1.000
854     151 152 1.000
855     151 153 1.000
856     151 154 1.000
857     151 155 1.000
858     151 170 1.000
859     151 171 1.000
860     152 153 1.000
861     152 171 1.000
862     152 172 1.000
863     153 154 1.000
864     153 155 1.000
865     153 171 1.000
866     153 172 1.000
867     153 173 1.000
868     154 155 1.000
869     154 171 1.000
870     154 317 1.000
871     154 318 1.000
872     154 319 1.000
873     155 156 1.000
874     155 157 1.000
875     155 170 1.000
876     155 171 1.000
877     155 172 1.000
878     155 173 1.000
879     155 315 1.000
880     155 316 1.000
881     155 317 1.000
882     155 318 1.000
883     155 319 1.000
884     156 157 1.000
885     156 158 1.000
886     156 168 1.000
887     156 169 1.000
888     156 170 1.000
889     156 171 1.000
890     156 316 1.000
891     157 158 1.000
892     157 159 1.000
893     157 167 1.000
894     157 168 1.000
895     157 169 1.000
896     157 173 1.000
897     157 174 1.000
898     157 177 1.000
899     157 313 1.000
900     157 314 1.000
901     157 315 1.000
902     157 316 1.000
903     158 159 1.000
904     158 160 1.000
905     158 168 1.000
906     158 219 1.000
907     158 309 1.000
908     158 313 1.000
909     158 314 1.000
910     158 316 1.000
911     159 160 1.000
912     159 161 1.000
913     159 166 1.000
914     159 167 1.000
915     159 168 1.000
916     159 169 1.000
917     159 174 1.000
918     159 177 1.000
919     159 178 1.000
920     159 313 1.000
921     159 314 1.000
922     159 329 1.000
923     160 161 1.000
924     160 162 1.000
925     160 166 1.000
926     160 219 1.000
927     160 306 1.000
928     160 309 1.000
929     160 310 1.000
930     161 162 1.000
931     161 163 1.000
932     161 164 1.000
933     161 165 1.000
934     161 166 1.000
935     161 310 1.000
936     162 163 1.000
937     162 164 1.000
938     162 273 1.000
939     162 275 1.000
940     162 276 1.000
941     162 310 1.000
942     162 311 1.000
943     163 164 1.000
944     164 165 1.000
945     164 166 1.000
946     165 166 1.000
947     165 167 1.000
948     166 167 1.000
949     166 168 1.000
950     167 168 1.000
951     167 169 1.000
952     167 174 1.000
953     167 177 1.000
954     168 169 1.000
955     168 170 1.000
956     169 170 1.000
957     169 171 1.000
958     169 172 1.000
959     169 173 1.000
960     169 174 1.000
961     170 171 1.000
962     170 172 1.000
963     171 172 1.000
964     171 173 1.000
965     172 173 1.000
966     172 174 1.000
967     173 174 1.000
968     173 175 1.000
969     173 182 1.000
970     173 315 1.000
971     174 175 1.000
972     174 176 1.000
973     174 177 1.000
974     174 178 1.000
975     175 176 1.000
976     175 177 1.000
977     175 178 1.000
978     176 177 1.000
979     177 178 1.000
980     177 313 1.000
981     177 329 1.000
982     178 179 1.000
983     178 180 1.000
984     178 182 1.000
985     178 312 1.000
986     178 313 1.000
987     178 327 1.000
988     178 328 1.000
989     178 329 1.000
990     179 180 1.000
991     179 327 1.000
992     179 328 1.000
993     179 329 1.000
994     180 181 1.000
995     180 327 1.000
996     180 328 1.000
997     181 182 1.000
998     181 183 1.000
999     181 327 1.000
1000     182 183 1.000
1001     182 184 1.000
1002     182 313 1.000
1003     182 315 1.000
1004     182 325 1.000
1005     182 326 1.000
1006     182 327 1.000
1007     183 184 1.000
1008     183 185 1.000
1009     183 265 1.000
1010     183 266 1.000
1011     183 267 1.000
1012     183 268 1.000
1013     183 325 1.000
1014     183 326 1.000
1015     183 327 1.000
1016     184 185 1.000
1017     184 315 1.000
1018     184 317 1.000
1019     184 323 1.000
1020     184 324 1.000
1021     184 325 1.000
1022     185 186 1.000
1023     185 187 1.000
1024     185 196 1.000
1025     185 197 1.000
1026     185 265 1.000
1027     185 266 1.000
1028     185 323 1.000
1029     185 324 1.000
1030     185 325 1.000
1031     185 326 1.000
1032     186 187 1.000
1033     186 188 1.000
1034     186 196 1.000
1035     186 197 1.000
1036     186 323 1.000
1037     186 324 1.000
1038     187 188 1.000
1039     187 189 1.000
1040     187 194 1.000
1041     187 195 1.000
1042     187 196 1.000
1043     187 322 1.000
1044     187 323 1.000
1045     187 324 1.000
1046     188 189 1.000
1047     188 190 1.000
1048     188 191 1.000
1049     188 195 1.000
1050     188 196 1.000
1051     189 190 1.000
1052     189 191 1.000
1053     189 192 1.000
1054     189 193 1.000
1055     189 195 1.000
1056     189 322 1.000
1057     190 191 1.000
1058     190 192 1.000
1059     190 195 1.000
1060     191 192 1.000
1061     191 193 1.000
1062     191 195 1.000
1063     191 216 1.000
1064     192 193 1.000
1065     192 195 1.000
1066     193 194 1.000
1067     193 195 1.000
1068     193 215 1.000
1069     193 216 1.000
1070     193 217 1.000
1071     193 218 1.000
1072     194 195 1.000
1073     194 196 1.000
1074     194 216 1.000
1075     194 217 1.000
1076     194 218 1.000
1077     194 316 1.000
1078     194 322 1.000
1079     194 324 1.000
1080     195 196 1.000
1081     195 214 1.000
1082     195 215 1.000
1083     195 216 1.000
1084     196 197 1.000
1085     196 198 1.000
1086     196 214 1.000
1087     196 215 1.000
1088     196 216 1.000
1089     196 217 1.000
1090     196 324 1.000
1091     197 198 1.000
1092     197 199 1.000
1093     197 212 1.000
1094     197 213 1.000
1095     197 214 1.000
1096     197 215 1.000
1097     198 199 1.000
1098     198 200 1.000
1099     198 201 1.000
1100     198 212 1.000
1101     198 213 1.000
1102     198 214 1.000
1103     198 215 1.000
1104     198 263 1.000
1105     198 264 1.000
1106     198 265 1.000
1107     198 304 1.000
1108     199 200 1.000
1109     199 210 1.000
1110     199 212 1.000
1111     199 264 1.000
1112     199 265 1.000
1113     199 266 1.000
1114     199 267 1.000
1115     200 201 1.000
1116     200 202 1.000
1117     200 208 1.000
1118     200 209 1.000
1119     200 210 1.000
1120     200 211 1.000
1121     200 212 1.000
1122     200 213 1.000
1123     200 263 1.000
1124     200 264 1.000
1125     201 202 1.000
1126     201 203 1.000
1127     201 208 1.000
1128     201 209 1.000
1129     201 211 1.000
1130     201 213 1.000
1131     201 226 1.000
1132     201 230 1.000
1133     201 261 1.000
1134     201 262 1.000
1135     201 263 1.000
1136     201 264 1.000
1137     202 203 1.000
1138     202 204 1.000
1139     202 206 1.000
1140     202 207 1.000
1141     202 208 1.000
1142     202 209 1.000
1143     202 261 1.000
1144     202 262 1.000
1145     202 269 1.000
1146     203 204 1.000
1147     203 206 1.000
1148     203 233 1.000
1149     203 234 1.000
1150     203 236 1.000
1151     203 237 1.000
1152     203 259 1.000
1153     203 260 1.000
1154     203 261 1.000
1155     203 262 1.000
1156     204 205 1.000
1157     204 206 1.000
1158     204 237 1.000
1159     204 259 1.000
1160     204 260 1.000
1161     204 261 1.000
1162     204 262 1.000
1163     205 206 1.000
1164     205 259 1.000
1165     206 207 1.000
1166     206 208 1.000
1167     207 208 1.000
1168     207 209 1.000
1169     208 209 1.000
1170     208 210 1.000
1171     208 262 1.000
1172     208 264 1.000
1173     208 269 1.000
1174     209 210 1.000
1175     209 211 1.000
1176     210 211 1.000
1177     211 212 1.000
1178     211 213 1.000
1179     211 230 1.000
1180     212 213 1.000
1181     212 214 1.000
1182     213 214 1.000
1183     213 215 1.000
1184     213 226 1.000
1185     213 227 1.000
1186     213 230 1.000
1187     213 263 1.000
1188     213 302 1.000
1189     214 215 1.000
1190     214 301 1.000
1191     214 302 1.000
1192     215 216 1.000
1193     215 217 1.000
1194     215 301 1.000
1195     215 302 1.000
1196     215 303 1.000
1197     215 304 1.000
1198     216 217 1.000
1199     216 218 1.000
1200     216 301 1.000
1201     216 302 1.000
1202     216 303 1.000
1203     216 304 1.000
1204     217 218 1.000
1205     217 219 1.000
1206     217 304 1.000
1207     217 305 1.000
1208     217 309 1.000
1209     217 314 1.000
1210     217 316 1.000
1211     217 324 1.000
1212     218 219 1.000
1213     218 220 1.000
1214     218 221 1.000
1215     218 303 1.000
1216     218 304 1.000
1217     218 305 1.000
1218     218 309 1.000
1219     219 220 1.000
1220     219 221 1.000
1221     219 305 1.000
1222     219 306 1.000
1223     219 309 1.000
1224     220 221 1.000
1225     220 222 1.000
1226     220 305 1.000
1227     220 306 1.000
1228     221 222 1.000
1229     221 223 1.000
1230     221 225 1.000
1231     221 303 1.000
1232     221 305 1.000
1233     221 306 1.000
1234     222 223 1.000
1235     222 279 1.000
1236     222 305 1.000
1237     222 306 1.000
1238     222 307 1.000
1239     223 224 1.000
1240     223 225 1.000
1241     223 279 1.000
1242     223 291 1.000
1243     223 292 1.000
1244     223 293 1.000
1245     223 294 1.000
1246     223 303 1.000
1247     223 305 1.000
1248     223 306 1.000
1249     223 307 1.000
1250     224 225 1.000
1251     224 226 1.000
1252     224 261 1.000
1253     224 272 1.000
1254     224 277 1.000
1255     224 292 1.000
1256     224 293 1.000
1257     224 294 1.000
1258     224 303 1.000
1259     224 304 1.000
1260     224 305 1.000
1261     224 307 1.000
1262     224 308 1.000
1263     225 226 1.000
1264     225 293 1.000
1265     225 294 1.000
1266     225 295 1.000
1267     225 296 1.000
1268     225 299 1.000
1269     225 301 1.000
1270     225 302 1.000
1271     225 303 1.000
1272     225 305 1.000
1273     226 227 1.000
1274     226 230 1.000
1275     226 231 1.000
1276     226 293 1.000
1277     226 294 1.000
1278     226 295 1.000
1279     226 296 1.000
1280     226 302 1.000
1281     227 228 1.000
1282     227 229 1.000
1283     227 230 1.000
1284     227 231 1.000
1285     227 295 1.000
1286     227 296 1.000
1287     227 297 1.000
1288     227 302 1.000
1289     228 229 1.000
1290     228 230 1.000
1291     228 231 1.000
1292     228 232 1.000
1293     228 295 1.000
1294     228 296 1.000
1295     228 297 1.000
1296     229 230 1.000
1297     229 231 1.000
1298     229 232 1.000
1299     229 233 1.000
1300     230 231 1.000
1301     230 232 1.000
1302     230 233 1.000
1303     230 234 1.000
1304     231 232 1.000
1305     231 233 1.000
1306     231 234 1.000
1307     231 235 1.000
1308     231 250 1.000
1309     231 293 1.000
1310     231 294 1.000
1311     231 295 1.000
1312     231 296 1.000
1313     232 233 1.000
1314     232 234 1.000
1315     232 235 1.000
1316     232 236 1.000
1317     233 234 1.000
1318     233 235 1.000
1319     233 236 1.000
1320     233 237 1.000
1321     234 235 1.000
1322     234 236 1.000
1323     234 237 1.000
1324     234 238 1.000
1325     234 259 1.000
1326     234 261 1.000
1327     234 277 1.000
1328     234 293 1.000
1329     235 236 1.000
1330     235 237 1.000
1331     235 238 1.000
1332     235 241 1.000
1333     235 242 1.000
1334     235 243 1.000
1335     235 250 1.000
1336     235 252 1.000
1337     235 293 1.000
1338     236 237 1.000
1339     236 238 1.000
1340     237 238 1.000
1341     237 259 1.000
1342     238 239 1.000
1343     238 240 1.000
1344     238 241 1.000
1345     238 252 1.000
1346     238 256 1.000
1347     238 258 1.000
1348     238 259 1.000
1349     239 240 1.000
1350     239 241 1.000
1351     239 256 1.000
1352     240 241 1.000
1353     240 242 1.000
1354     240 252 1.000
1355     240 253 1.000
1356     240 256 1.000
1357     241 242 1.000
1358     241 250 1.000
1359     241 251 1.000
1360     241 252 1.000
1361     241 256 1.000
1362     241 291 1.000
1363     242 243 1.000
1364     242 244 1.000
1365     242 250 1.000
1366     242 251 1.000
1367     242 252 1.000
1368     243 244 1.000
1369     243 245 1.000
1370     243 248 1.000
1371     243 249 1.000
1372     243 250 1.000
1373     243 251 1.000
1374     244 245 1.000
1375     244 246 1.000
1376     244 247 1.000
1377     244 248 1.000
1378     244 249 1.000
1379     244 250 1.000
1380     244 251 1.000
1381     245 246 1.000
1382     245 247 1.000
1383     245 248 1.000
1384     246 247 1.000
1385     246 248 1.000
1386     247 248 1.000
1387     247 249 1.000
1388     247 251 1.000
1389     247 282 1.000
1390     247 288 1.000
1391     247 290 1.000
1392     248 249 1.000
1393     249 250 1.000
1394     249 251 1.000
1395     249 290 1.000
1396     249 291 1.000
1397     249 294 1.000
1398     249 295 1.000
1399     250 251 1.000
1400     250 252 1.000
1401     250 290 1.000
1402     250 291 1.000
1403     250 293 1.000
1404     250 294 1.000
1405     251 252 1.000
1406     251 282 1.000
1407     251 288 1.000
1408     251 289 1.000
1409     251 290 1.000
1410     251 291 1.000
1411     252 253 1.000
1412     252 254 1.000
1413     252 256 1.000
1414     252 258 1.000
1415     252 288 1.000
1416     252 289 1.000
1417     252 291 1.000
1418     253 254 1.000
1419     253 255 1.000
1420     253 256 1.000
1421     253 287 1.000
1422     253 288 1.000
1423     253 289 1.000
1424     254 255 1.000
1425     254 256 1.000
1426     254 278 1.000
1427     254 280 1.000
1428     254 281 1.000
1429     254 286 1.000
1430     254 287 1.000
1431     254 288 1.000
1432     254 289 1.000
1433     255 256 1.000
1434     255 287 1.000
1435     256 257 1.000
1436     256 258 1.000
1437     256 278 1.000
1438     256 289 1.000
1439     257 258 1.000
1440     257 274 1.000
1441     258 259 1.000
1442     258 260 1.000
1443     258 274 1.000
1444     258 275 1.000
1445     258 277 1.000
1446     258 278 1.000
1447     259 260 1.000
1448     259 261 1.000
1449     259 274 1.000
1450     260 261 1.000
1451     260 262 1.000
1452     260 271 1.000
1453     260 272 1.000
1454     260 273 1.000
1455     260 274 1.000
1456     260 277 1.000
1457     261 262 1.000
1458     261 263 1.000
1459     261 271 1.000
1460     261 272 1.000
1461     261 274 1.000
1462     261 277 1.000
1463     261 293 1.000
1464     262 263 1.000
1465     262 264 1.000
1466     262 269 1.000
1467     262 270 1.000
1468     262 271 1.000
1469     262 272 1.000
1470     263 264 1.000
1471     263 265 1.000
1472     263 269 1.000
1473     263 270 1.000
1474     263 272 1.000
1475     263 304 1.000
1476     263 308 1.000
1477     264 265 1.000
1478     264 266 1.000
1479     264 268 1.000
1480     264 269 1.000
1481     264 270 1.000
1482     265 266 1.000
1483     265 268 1.000
1484     265 269 1.000
1485     265 270 1.000
1486     265 325 1.000
1487     265 326 1.000
1488     266 267 1.000
1489     266 268 1.000
1490     267 268 1.000
1491     268 269 1.000
1492     268 270 1.000
1493     268 326 1.000
1494     269 270 1.000
1495     269 271 1.000
1496     270 271 1.000
1497     270 272 1.000
1498     270 308 1.000
1499     270 311 1.000
1500     270 312 1.000
1501     270 326 1.000
1502     270 328 1.000
1503     271 272 1.000
1504     271 273 1.000
1505     271 311 1.000
1506     271 328 1.000
1507     272 273 1.000
1508     272 274 1.000
1509     272 276 1.000
1510     272 277 1.000
1511     272 307 1.000
1512     272 308 1.000
1513     272 311 1.000
1514     273 274 1.000
1515     273 275 1.000
1516     273 276 1.000
1517     273 277 1.000
1518     273 311 1.000
1519     274 275 1.000
1520     274 276 1.000
1521     274 277 1.000
1522     274 278 1.000
1523     275 276 1.000
1524     275 277 1.000
1525     275 278 1.000
1526     276 277 1.000
1527     276 278 1.000
1528     276 292 1.000
1529     276 307 1.000
1530     276 310 1.000
1531     276 311 1.000
1532     277 278 1.000
1533     277 279 1.000
1534     277 291 1.000
1535     277 292 1.000
1536     277 293 1.000
1537     277 307 1.000
1538     278 279 1.000
1539     278 280 1.000
1540     278 289 1.000
1541     278 291 1.000
1542     278 292 1.000
1543     279 280 1.000
1544     279 289 1.000
1545     279 290 1.000
1546     279 291 1.000
1547     279 292 1.000
1548     279 307 1.000
1549     280 281 1.000
1550     280 282 1.000
1551     280 289 1.000
1552     280 290 1.000
1553     280 291 1.000
1554     281 282 1.000
1555     281 283 1.000
1556     281 284 1.000
1557     281 285 1.000
1558     281 286 1.000
1559     281 288 1.000
1560     281 289 1.000
1561     281 290 1.000
1562     282 283 1.000
1563     282 286 1.000
1564     282 288 1.000
1565     282 289 1.000
1566     282 290 1.000
1567     283 284 1.000
1568     283 285 1.000
1569     283 286 1.000
1570     284 285 1.000
1571     284 286 1.000
1572     285 286 1.000
1573     285 287 1.000
1574     286 287 1.000
1575     286 288 1.000
1576     286 289 1.000
1577     287 288 1.000
1578     288 289 1.000
1579     288 290 1.000
1580     289 290 1.000
1581     289 291 1.000
1582     290 291 1.000
1583     290 292 1.000
1584     291 292 1.000
1585     291 293 1.000
1586     291 294 1.000
1587     292 293 1.000
1588     292 294 1.000
1589     292 307 1.000
1590     293 294 1.000
1591     293 307 1.000
1592     294 295 1.000
1593     294 296 1.000
1594     295 296 1.000
1595     295 297 1.000
1596     295 298 1.000
1597     296 297 1.000
1598     296 298 1.000
1599     296 299 1.000
1600     296 300 1.000
1601     296 301 1.000
1602     296 302 1.000
1603     296 303 1.000
1604     297 298 1.000
1605     297 299 1.000
1606     297 300 1.000
1607     298 299 1.000
1608     298 300 1.000
1609     299 300 1.000
1610     299 301 1.000
1611     299 302 1.000
1612     299 303 1.000
1613     300 301 1.000
1614     300 302 1.000
1615     301 302 1.000
1616     301 303 1.000
1617     302 303 1.000
1618     302 304 1.000
1619     303 304 1.000
1620     303 305 1.000
1621     304 305 1.000
1622     304 308 1.000
1623     304 309 1.000
1624     305 306 1.000
1625     305 307 1.000
1626     305 308 1.000
1627     305 309 1.000
1628     306 307 1.000
1629     306 308 1.000
1630     306 309 1.000
1631     306 310 1.000
1632     307 308 1.000
1633     307 309 1.000
1634     307 310 1.000
1635     307 311 1.000
1636     308 309 1.000
1637     308 310 1.000
1638     308 311 1.000
1639     308 312 1.000
1640     309 310 1.000
1641     309 311 1.000
1642     309 312 1.000
1643     309 314 1.000
1644     310 311 1.000
1645     310 312 1.000
1646     311 312 1.000
1647     311 329 1.000
1648     312 313 1.000
1649     312 314 1.000
1650     312 326 1.000
1651     312 327 1.000
1652     312 328 1.000
1653     312 329 1.000
1654     313 314 1.000
1655     313 315 1.000
1656     313 326 1.000
1657     313 327 1.000
1658     313 328 1.000
1659     313 329 1.000
1660     314 315 1.000
1661     314 316 1.000
1662     314 324 1.000
1663     314 325 1.000
1664     314 326 1.000
1665     315 316 1.000
1666     315 317 1.000
1667     315 324 1.000
1668     315 325 1.000
1669     315 326 1.000
1670     315 327 1.000
1671     316 317 1.000
1672     316 318 1.000
1673     316 322 1.000
1674     316 324 1.000
1675     316 325 1.000
1676     317 318 1.000
1677     317 319 1.000
1678     317 322 1.000
1679     317 323 1.000
1680     317 324 1.000
1681     317 325 1.000
1682     318 319 1.000
1683     318 320 1.000
1684     318 322 1.000
1685     318 323 1.000
1686     319 320 1.000
1687     319 321 1.000
1688     319 322 1.000
1689     319 323 1.000
1690     320 321 1.000
1691     320 322 1.000
1692     321 322 1.000
1693     321 323 1.000
1694     322 323 1.000
1695     322 324 1.000
1696     323 324 1.000
1697     323 325 1.000
1698     324 325 1.000
1699     324 326 1.000
1700     325 326 1.000
1701     325 327 1.000
1702     326 327 1.000
1703     326 328 1.000
1704     327 328 1.000
1705     327 329 1.000
1706     328 329 1.000