ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/3nulA_ALL_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 3 months ago) by hstehr
File size: 8956 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3     #PDB: 3nul
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: ALL
8     #CUTOFF: 5.0
9     1 2 1.000
10     1 3 1.000
11     1 4 1.000
12     1 5 1.000
13     2 3 1.000
14     2 4 1.000
15     2 5 1.000
16     2 6 1.000
17     2 24 1.000
18     2 32 1.000
19     2 33 1.000
20     2 125 1.000
21     2 130 1.000
22     3 4 1.000
23     3 5 1.000
24     3 6 1.000
25     3 7 1.000
26     3 8 1.000
27     3 33 1.000
28     3 34 1.000
29     3 35 1.000
30     4 5 1.000
31     4 6 1.000
32     4 7 1.000
33     4 8 1.000
34     4 9 1.000
35     5 6 1.000
36     5 7 1.000
37     5 8 1.000
38     5 9 1.000
39     5 10 1.000
40     5 24 1.000
41     5 121 1.000
42     5 124 1.000
43     5 125 1.000
44     5 130 1.000
45     6 7 1.000
46     6 8 1.000
47     6 9 1.000
48     6 10 1.000
49     6 22 1.000
50     6 23 1.000
51     6 24 1.000
52     6 33 1.000
53     6 34 1.000
54     6 35 1.000
55     7 8 1.000
56     7 9 1.000
57     7 10 1.000
58     7 12 1.000
59     8 9 1.000
60     8 10 1.000
61     8 12 1.000
62     9 10 1.000
63     9 12 1.000
64     9 117 1.000
65     9 120 1.000
66     9 121 1.000
67     10 12 1.000
68     10 19 1.000
69     10 22 1.000
70     10 23 1.000
71     10 24 1.000
72     10 101 1.000
73     10 102 1.000
74     10 117 1.000
75     10 118 1.000
76     10 121 1.000
77     12 13 1.000
78     12 14 1.000
79     12 17 1.000
80     12 18 1.000
81     12 19 1.000
82     12 120 1.000
83     13 14 1.000
84     13 15 1.000
85     13 16 1.000
86     13 17 1.000
87     13 18 1.000
88     14 15 1.000
89     14 16 1.000
90     14 17 1.000
91     14 18 1.000
92     14 113 1.000
93     14 117 1.000
94     15 16 1.000
95     15 17 1.000
96     15 113 1.000
97     16 17 1.000
98     16 18 1.000
99     17 18 1.000
100     17 19 1.000
101     17 108 1.000
102     17 113 1.000
103     18 19 1.000
104     18 20 1.000
105     19 20 1.000
106     19 21 1.000
107     19 22 1.000
108     19 102 1.000
109     19 103 1.000
110     19 104 1.000
111     19 105 1.000
112     19 114 1.000
113     19 117 1.000
114     19 118 1.000
115     20 21 1.000
116     20 22 1.000
117     20 35 1.000
118     20 37 1.000
119     20 104 1.000
120     20 105 1.000
121     20 106 1.000
122     21 22 1.000
123     21 23 1.000
124     21 35 1.000
125     21 37 1.000
126     21 38 1.000
127     21 39 1.000
128     21 102 1.000
129     21 103 1.000
130     21 104 1.000
131     22 23 1.000
132     22 24 1.000
133     22 33 1.000
134     22 34 1.000
135     22 35 1.000
136     22 38 1.000
137     22 102 1.000
138     22 103 1.000
139     22 104 1.000
140     23 24 1.000
141     23 25 1.000
142     23 33 1.000
143     23 34 1.000
144     23 35 1.000
145     23 38 1.000
146     23 100 1.000
147     23 101 1.000
148     23 102 1.000
149     24 25 1.000
150     24 26 1.000
151     24 30 1.000
152     24 31 1.000
153     24 32 1.000
154     24 33 1.000
155     24 34 1.000
156     24 99 1.000
157     24 100 1.000
158     24 101 1.000
159     24 102 1.000
160     24 121 1.000
161     24 125 1.000
162     25 26 1.000
163     25 27 1.000
164     25 29 1.000
165     25 30 1.000
166     25 31 1.000
167     25 32 1.000
168     25 33 1.000
169     25 38 1.000
170     25 41 1.000
171     25 46 1.000
172     25 98 1.000
173     25 99 1.000
174     25 100 1.000
175     25 102 1.000
176     26 27 1.000
177     26 28 1.000
178     26 29 1.000
179     26 30 1.000
180     26 32 1.000
181     26 98 1.000
182     26 99 1.000
183     26 100 1.000
184     27 28 1.000
185     27 29 1.000
186     27 46 1.000
187     27 50 1.000
188     27 95 1.000
189     27 96 1.000
190     27 97 1.000
191     27 98 1.000
192     27 99 1.000
193     27 100 1.000
194     28 29 1.000
195     28 30 1.000
196     28 32 1.000
197     28 46 1.000
198     28 50 1.000
199     29 30 1.000
200     29 31 1.000
201     29 46 1.000
202     30 31 1.000
203     30 32 1.000
204     31 32 1.000
205     31 33 1.000
206     31 34 1.000
207     32 33 1.000
208     32 34 1.000
209     32 98 1.000
210     32 99 1.000
211     33 34 1.000
212     33 35 1.000
213     34 35 1.000
214     34 36 1.000
215     34 38 1.000
216     35 36 1.000
217     35 37 1.000
218     35 38 1.000
219     36 37 1.000
220     36 38 1.000
221     37 38 1.000
222     37 39 1.000
223     38 39 1.000
224     38 40 1.000
225     38 41 1.000
226     38 102 1.000
227     38 104 1.000
228     39 40 1.000
229     39 41 1.000
230     39 67 1.000
231     39 104 1.000
232     40 41 1.000
233     40 42 1.000
234     40 45 1.000
235     40 67 1.000
236     41 42 1.000
237     41 43 1.000
238     41 45 1.000
239     41 46 1.000
240     41 66 1.000
241     41 67 1.000
242     41 102 1.000
243     41 104 1.000
244     42 43 1.000
245     42 44 1.000
246     42 45 1.000
247     42 46 1.000
248     42 67 1.000
249     42 68 1.000
250     43 44 1.000
251     43 45 1.000
252     43 46 1.000
253     43 47 1.000
254     44 45 1.000
255     44 46 1.000
256     44 47 1.000
257     44 48 1.000
258     45 46 1.000
259     45 47 1.000
260     45 48 1.000
261     45 49 1.000
262     45 65 1.000
263     45 66 1.000
264     45 67 1.000
265     45 68 1.000
266     45 69 1.000
267     46 47 1.000
268     46 48 1.000
269     46 49 1.000
270     46 50 1.000
271     46 100 1.000
272     47 48 1.000
273     47 49 1.000
274     47 50 1.000
275     47 51 1.000
276     47 52 1.000
277     48 49 1.000
278     48 50 1.000
279     48 51 1.000
280     48 52 1.000
281     48 58 1.000
282     48 59 1.000
283     49 50 1.000
284     49 51 1.000
285     49 52 1.000
286     49 53 1.000
287     49 59 1.000
288     49 64 1.000
289     49 66 1.000
290     49 82 1.000
291     49 93 1.000
292     49 100 1.000
293     49 102 1.000
294     50 51 1.000
295     50 52 1.000
296     50 53 1.000
297     50 54 1.000
298     50 100 1.000
299     51 52 1.000
300     51 53 1.000
301     51 54 1.000
302     51 55 1.000
303     51 56 1.000
304     51 58 1.000
305     52 53 1.000
306     52 54 1.000
307     52 55 1.000
308     52 56 1.000
309     52 57 1.000
310     52 58 1.000
311     52 59 1.000
312     52 60 1.000
313     52 82 1.000
314     53 54 1.000
315     53 55 1.000
316     53 56 1.000
317     53 78 1.000
318     53 79 1.000
319     53 80 1.000
320     53 81 1.000
321     53 82 1.000
322     53 93 1.000
323     53 94 1.000
324     53 95 1.000
325     53 100 1.000
326     54 55 1.000
327     54 56 1.000
328     55 56 1.000
329     55 57 1.000
330     55 58 1.000
331     56 57 1.000
332     56 58 1.000
333     56 78 1.000
334     56 79 1.000
335     57 58 1.000
336     57 59 1.000
337     57 60 1.000
338     57 61 1.000
339     58 59 1.000
340     58 60 1.000
341     58 61 1.000
342     59 60 1.000
343     59 61 1.000
344     59 62 1.000
345     59 63 1.000
346     59 64 1.000
347     59 73 1.000
348     59 82 1.000
349     60 61 1.000
350     60 62 1.000
351     60 63 1.000
352     60 73 1.000
353     61 62 1.000
354     61 63 1.000
355     62 63 1.000
356     62 64 1.000
357     62 65 1.000
358     62 70 1.000
359     63 64 1.000
360     63 65 1.000
361     63 70 1.000
362     63 71 1.000
363     63 73 1.000
364     64 65 1.000
365     64 66 1.000
366     64 69 1.000
367     64 70 1.000
368     64 71 1.000
369     64 73 1.000
370     64 82 1.000
371     64 83 1.000
372     64 84 1.000
373     64 91 1.000
374     64 93 1.000
375     65 66 1.000
376     65 67 1.000
377     65 68 1.000
378     65 69 1.000
379     65 70 1.000
380     65 71 1.000
381     66 67 1.000
382     66 68 1.000
383     66 69 1.000
384     66 71 1.000
385     66 91 1.000
386     66 93 1.000
387     66 102 1.000
388     66 104 1.000
389     67 68 1.000
390     67 69 1.000
391     68 69 1.000
392     68 70 1.000
393     69 70 1.000
394     69 71 1.000
395     69 86 1.000
396     70 71 1.000
397     70 85 1.000
398     70 86 1.000
399     71 73 1.000
400     71 84 1.000
401     71 85 1.000
402     71 86 1.000
403     71 90 1.000
404     71 91 1.000
405     71 104 1.000
406     73 74 1.000
407     73 75 1.000
408     73 83 1.000
409     73 84 1.000
410     74 75 1.000
411     74 76 1.000
412     74 83 1.000
413     74 84 1.000
414     74 85 1.000
415     75 76 1.000
416     75 77 1.000
417     75 83 1.000
418     76 77 1.000
419     76 78 1.000
420     76 81 1.000
421     76 82 1.000
422     76 83 1.000
423     77 78 1.000
424     77 79 1.000
425     77 80 1.000
426     77 81 1.000
427     77 83 1.000
428     77 94 1.000
429     77 119 1.000
430     78 79 1.000
431     78 80 1.000
432     79 80 1.000
433     79 81 1.000
434     79 95 1.000
435     80 81 1.000
436     80 82 1.000
437     80 93 1.000
438     80 94 1.000
439     80 95 1.000
440     81 82 1.000
441     81 83 1.000
442     81 92 1.000
443     81 93 1.000
444     81 94 1.000
445     81 119 1.000
446     82 83 1.000
447     82 84 1.000
448     82 91 1.000
449     82 92 1.000
450     82 93 1.000
451     83 84 1.000
452     83 85 1.000
453     83 91 1.000
454     83 92 1.000
455     83 115 1.000
456     83 119 1.000
457     84 85 1.000
458     84 86 1.000
459     84 89 1.000
460     84 90 1.000
461     84 91 1.000
462     84 105 1.000
463     85 86 1.000
464     85 87 1.000
465     85 88 1.000
466     85 89 1.000
467     85 90 1.000
468     85 91 1.000
469     85 105 1.000
470     86 87 1.000
471     86 88 1.000
472     86 89 1.000
473     86 90 1.000
474     87 88 1.000
475     87 89 1.000
476     88 89 1.000
477     88 90 1.000
478     88 105 1.000
479     88 106 1.000
480     88 107 1.000
481     89 90 1.000
482     89 91 1.000
483     89 105 1.000
484     89 106 1.000
485     89 107 1.000
486     90 91 1.000
487     90 92 1.000
488     90 103 1.000
489     90 104 1.000
490     90 105 1.000
491     91 92 1.000
492     91 93 1.000
493     91 103 1.000
494     91 104 1.000
495     91 105 1.000
496     91 114 1.000
497     92 93 1.000
498     92 94 1.000
499     92 101 1.000
500     92 102 1.000
501     92 103 1.000
502     92 111 1.000
503     92 114 1.000
504     92 115 1.000
505     92 118 1.000
506     92 119 1.000
507     93 94 1.000
508     93 95 1.000
509     93 100 1.000
510     93 101 1.000
511     93 102 1.000
512     93 118 1.000
513     94 95 1.000
514     94 96 1.000
515     94 99 1.000
516     94 100 1.000
517     94 101 1.000
518     94 118 1.000
519     94 119 1.000
520     94 122 1.000
521     94 123 1.000
522     94 126 1.000
523     95 96 1.000
524     95 97 1.000
525     95 99 1.000
526     95 100 1.000
527     95 126 1.000
528     96 97 1.000
529     96 98 1.000
530     96 99 1.000
531     96 100 1.000
532     96 101 1.000
533     96 122 1.000
534     96 125 1.000
535     96 126 1.000
536     96 130 1.000
537     97 98 1.000
538     97 99 1.000
539     97 125 1.000
540     97 126 1.000
541     97 129 1.000
542     97 130 1.000
543     98 99 1.000
544     98 100 1.000
545     98 129 1.000
546     98 130 1.000
547     99 100 1.000
548     99 101 1.000
549     99 130 1.000
550     100 101 1.000
551     100 102 1.000
552     101 102 1.000
553     101 103 1.000
554     101 118 1.000
555     101 121 1.000
556     101 122 1.000
557     101 125 1.000
558     102 103 1.000
559     102 104 1.000
560     102 118 1.000
561     103 104 1.000
562     103 105 1.000
563     103 114 1.000
564     103 118 1.000
565     104 105 1.000
566     104 106 1.000
567     104 114 1.000
568     105 106 1.000
569     105 107 1.000
570     105 110 1.000
571     105 111 1.000
572     105 114 1.000
573     106 107 1.000
574     106 108 1.000
575     107 108 1.000
576     108 110 1.000
577     108 113 1.000
578     110 111 1.000
579     110 112 1.000
580     110 113 1.000
581     110 114 1.000
582     110 115 1.000
583     111 112 1.000
584     111 113 1.000
585     111 114 1.000
586     111 115 1.000
587     111 116 1.000
588     112 113 1.000
589     112 114 1.000
590     112 115 1.000
591     112 116 1.000
592     113 114 1.000
593     113 115 1.000
594     113 116 1.000
595     113 117 1.000
596     114 115 1.000
597     114 116 1.000
598     114 117 1.000
599     114 118 1.000
600     114 119 1.000
601     115 116 1.000
602     115 117 1.000
603     115 118 1.000
604     115 119 1.000
605     115 120 1.000
606     116 117 1.000
607     116 118 1.000
608     116 119 1.000
609     116 120 1.000
610     116 121 1.000
611     117 118 1.000
612     117 119 1.000
613     117 120 1.000
614     117 121 1.000
615     118 119 1.000
616     118 120 1.000
617     118 121 1.000
618     118 122 1.000
619     119 120 1.000
620     119 121 1.000
621     119 122 1.000
622     119 123 1.000
623     119 124 1.000
624     120 121 1.000
625     120 122 1.000
626     120 123 1.000
627     120 124 1.000
628     121 122 1.000
629     121 123 1.000
630     121 124 1.000
631     121 125 1.000
632     121 126 1.000
633     122 123 1.000
634     122 124 1.000
635     122 125 1.000
636     122 126 1.000
637     123 124 1.000
638     123 125 1.000
639     123 126 1.000
640     123 127 1.000
641     123 128 1.000
642     124 125 1.000
643     124 126 1.000
644     124 127 1.000
645     124 128 1.000
646     125 126 1.000
647     125 127 1.000
648     125 128 1.000
649     125 129 1.000
650     125 130 1.000
651     126 127 1.000
652     126 128 1.000
653     126 129 1.000
654     126 130 1.000
655     127 128 1.000
656     127 129 1.000
657     128 129 1.000
658     128 130 1.000
659     129 130 1.000