ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/3nulA_Cb_8.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 2 months ago) by hstehr
File size: 8258 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3     #PDB: 3nul
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: Cb
8     #CUTOFF: 8.0
9     1 2 1.000
10     1 3 1.000
11     1 4 1.000
12     1 5 1.000
13     1 33 1.000
14     2 3 1.000
15     2 4 1.000
16     2 5 1.000
17     2 6 1.000
18     2 24 1.000
19     2 32 1.000
20     2 33 1.000
21     3 4 1.000
22     3 5 1.000
23     3 6 1.000
24     3 7 1.000
25     3 33 1.000
26     4 5 1.000
27     4 6 1.000
28     4 7 1.000
29     4 8 1.000
30     4 9 1.000
31     5 6 1.000
32     5 7 1.000
33     5 8 1.000
34     5 9 1.000
35     5 10 1.000
36     5 24 1.000
37     5 33 1.000
38     5 121 1.000
39     5 125 1.000
40     6 7 1.000
41     6 8 1.000
42     6 9 1.000
43     6 10 1.000
44     6 22 1.000
45     6 23 1.000
46     6 24 1.000
47     6 33 1.000
48     6 34 1.000
49     6 35 1.000
50     7 8 1.000
51     7 9 1.000
52     7 10 1.000
53     7 35 1.000
54     8 9 1.000
55     8 12 1.000
56     9 10 1.000
57     9 12 1.000
58     9 117 1.000
59     9 120 1.000
60     9 121 1.000
61     9 124 1.000
62     10 12 1.000
63     10 19 1.000
64     10 22 1.000
65     10 24 1.000
66     10 35 1.000
67     10 101 1.000
68     10 103 1.000
69     10 117 1.000
70     10 118 1.000
71     10 121 1.000
72     12 13 1.000
73     12 14 1.000
74     12 18 1.000
75     12 117 1.000
76     13 14 1.000
77     13 15 1.000
78     13 16 1.000
79     13 17 1.000
80     13 18 1.000
81     14 15 1.000
82     14 16 1.000
83     14 17 1.000
84     14 18 1.000
85     14 113 1.000
86     14 116 1.000
87     14 117 1.000
88     15 16 1.000
89     15 17 1.000
90     15 108 1.000
91     15 113 1.000
92     16 17 1.000
93     16 18 1.000
94     17 18 1.000
95     17 105 1.000
96     17 108 1.000
97     17 113 1.000
98     18 19 1.000
99     19 20 1.000
100     19 21 1.000
101     19 22 1.000
102     19 35 1.000
103     19 103 1.000
104     19 104 1.000
105     19 105 1.000
106     19 114 1.000
107     19 117 1.000
108     20 21 1.000
109     20 37 1.000
110     20 104 1.000
111     20 105 1.000
112     20 106 1.000
113     21 22 1.000
114     21 23 1.000
115     21 34 1.000
116     21 35 1.000
117     21 36 1.000
118     21 37 1.000
119     21 38 1.000
120     21 39 1.000
121     21 102 1.000
122     21 103 1.000
123     21 104 1.000
124     22 23 1.000
125     22 24 1.000
126     22 34 1.000
127     22 35 1.000
128     22 38 1.000
129     22 101 1.000
130     22 102 1.000
131     22 103 1.000
132     22 104 1.000
133     22 117 1.000
134     22 118 1.000
135     23 24 1.000
136     23 25 1.000
137     23 31 1.000
138     23 32 1.000
139     23 33 1.000
140     23 34 1.000
141     23 35 1.000
142     23 38 1.000
143     23 101 1.000
144     23 102 1.000
145     23 103 1.000
146     24 25 1.000
147     24 26 1.000
148     24 31 1.000
149     24 32 1.000
150     24 33 1.000
151     24 34 1.000
152     24 99 1.000
153     24 100 1.000
154     24 101 1.000
155     24 102 1.000
156     25 26 1.000
157     25 27 1.000
158     25 28 1.000
159     25 29 1.000
160     25 30 1.000
161     25 31 1.000
162     25 32 1.000
163     25 41 1.000
164     25 46 1.000
165     25 99 1.000
166     25 100 1.000
167     25 102 1.000
168     26 27 1.000
169     26 28 1.000
170     26 29 1.000
171     26 30 1.000
172     26 32 1.000
173     26 98 1.000
174     26 99 1.000
175     26 100 1.000
176     27 28 1.000
177     27 29 1.000
178     27 50 1.000
179     27 95 1.000
180     27 98 1.000
181     27 99 1.000
182     27 100 1.000
183     28 29 1.000
184     28 30 1.000
185     29 30 1.000
186     29 31 1.000
187     29 41 1.000
188     29 43 1.000
189     29 46 1.000
190     29 100 1.000
191     30 31 1.000
192     30 32 1.000
193     31 32 1.000
194     31 33 1.000
195     31 34 1.000
196     31 38 1.000
197     32 33 1.000
198     32 99 1.000
199     33 34 1.000
200     34 35 1.000
201     34 36 1.000
202     34 38 1.000
203     35 36 1.000
204     35 37 1.000
205     35 38 1.000
206     36 37 1.000
207     36 38 1.000
208     37 38 1.000
209     37 39 1.000
210     37 104 1.000
211     38 39 1.000
212     38 102 1.000
213     38 104 1.000
214     39 40 1.000
215     39 41 1.000
216     39 66 1.000
217     39 67 1.000
218     39 69 1.000
219     39 104 1.000
220     40 41 1.000
221     40 42 1.000
222     40 67 1.000
223     41 42 1.000
224     41 43 1.000
225     41 45 1.000
226     41 46 1.000
227     41 66 1.000
228     41 67 1.000
229     42 43 1.000
230     42 44 1.000
231     42 45 1.000
232     42 46 1.000
233     42 65 1.000
234     42 67 1.000
235     42 68 1.000
236     43 44 1.000
237     43 45 1.000
238     43 46 1.000
239     43 47 1.000
240     44 45 1.000
241     44 46 1.000
242     44 47 1.000
243     44 48 1.000
244     45 46 1.000
245     45 47 1.000
246     45 48 1.000
247     45 49 1.000
248     45 65 1.000
249     45 66 1.000
250     45 67 1.000
251     45 68 1.000
252     46 47 1.000
253     46 48 1.000
254     46 49 1.000
255     46 50 1.000
256     46 100 1.000
257     47 48 1.000
258     47 49 1.000
259     47 50 1.000
260     47 51 1.000
261     48 49 1.000
262     48 50 1.000
263     48 51 1.000
264     48 52 1.000
265     48 58 1.000
266     48 59 1.000
267     49 50 1.000
268     49 51 1.000
269     49 52 1.000
270     49 53 1.000
271     49 59 1.000
272     49 64 1.000
273     49 82 1.000
274     49 93 1.000
275     49 100 1.000
276     50 51 1.000
277     50 52 1.000
278     50 53 1.000
279     50 54 1.000
280     51 52 1.000
281     51 53 1.000
282     51 54 1.000
283     51 55 1.000
284     51 58 1.000
285     51 59 1.000
286     52 53 1.000
287     52 54 1.000
288     52 55 1.000
289     52 56 1.000
290     52 57 1.000
291     52 58 1.000
292     52 59 1.000
293     52 64 1.000
294     52 79 1.000
295     52 82 1.000
296     53 54 1.000
297     53 56 1.000
298     53 79 1.000
299     53 80 1.000
300     53 82 1.000
301     53 95 1.000
302     54 55 1.000
303     54 58 1.000
304     54 79 1.000
305     55 56 1.000
306     55 57 1.000
307     55 58 1.000
308     56 57 1.000
309     56 58 1.000
310     56 78 1.000
311     56 79 1.000
312     57 58 1.000
313     57 59 1.000
314     57 60 1.000
315     57 61 1.000
316     57 73 1.000
317     58 59 1.000
318     58 60 1.000
319     59 60 1.000
320     59 61 1.000
321     59 62 1.000
322     59 63 1.000
323     59 64 1.000
324     59 73 1.000
325     59 82 1.000
326     60 61 1.000
327     60 63 1.000
328     60 73 1.000
329     61 62 1.000
330     61 63 1.000
331     62 63 1.000
332     63 64 1.000
333     63 65 1.000
334     63 70 1.000
335     63 71 1.000
336     63 73 1.000
337     64 65 1.000
338     64 66 1.000
339     64 70 1.000
340     64 71 1.000
341     64 73 1.000
342     64 82 1.000
343     64 84 1.000
344     64 91 1.000
345     65 66 1.000
346     65 67 1.000
347     65 68 1.000
348     65 69 1.000
349     65 70 1.000
350     65 71 1.000
351     66 67 1.000
352     66 68 1.000
353     66 69 1.000
354     66 71 1.000
355     66 91 1.000
356     67 68 1.000
357     67 69 1.000
358     68 69 1.000
359     68 70 1.000
360     69 70 1.000
361     69 71 1.000
362     69 86 1.000
363     70 71 1.000
364     70 86 1.000
365     71 73 1.000
366     71 84 1.000
367     71 85 1.000
368     71 86 1.000
369     71 90 1.000
370     71 91 1.000
371     73 74 1.000
372     73 82 1.000
373     73 83 1.000
374     73 84 1.000
375     74 75 1.000
376     74 76 1.000
377     74 83 1.000
378     74 84 1.000
379     74 85 1.000
380     75 76 1.000
381     75 83 1.000
382     76 77 1.000
383     76 78 1.000
384     76 81 1.000
385     76 82 1.000
386     76 83 1.000
387     77 78 1.000
388     77 79 1.000
389     77 80 1.000
390     77 81 1.000
391     78 79 1.000
392     78 80 1.000
393     79 80 1.000
394     79 81 1.000
395     79 95 1.000
396     80 81 1.000
397     80 94 1.000
398     80 95 1.000
399     81 82 1.000
400     81 83 1.000
401     81 92 1.000
402     81 93 1.000
403     81 94 1.000
404     81 95 1.000
405     81 115 1.000
406     81 119 1.000
407     82 83 1.000
408     82 84 1.000
409     82 91 1.000
410     82 92 1.000
411     82 93 1.000
412     83 84 1.000
413     83 85 1.000
414     83 90 1.000
415     83 91 1.000
416     83 92 1.000
417     83 93 1.000
418     83 111 1.000
419     83 115 1.000
420     84 85 1.000
421     84 86 1.000
422     84 90 1.000
423     84 91 1.000
424     84 92 1.000
425     85 86 1.000
426     85 87 1.000
427     85 89 1.000
428     85 90 1.000
429     86 87 1.000
430     86 89 1.000
431     86 90 1.000
432     86 91 1.000
433     87 88 1.000
434     87 89 1.000
435     87 90 1.000
436     88 89 1.000
437     88 106 1.000
438     88 107 1.000
439     89 90 1.000
440     89 91 1.000
441     89 105 1.000
442     89 106 1.000
443     89 107 1.000
444     89 111 1.000
445     90 91 1.000
446     90 92 1.000
447     90 104 1.000
448     90 105 1.000
449     90 106 1.000
450     90 111 1.000
451     90 114 1.000
452     91 92 1.000
453     91 93 1.000
454     91 102 1.000
455     91 103 1.000
456     91 104 1.000
457     91 105 1.000
458     91 114 1.000
459     92 93 1.000
460     92 94 1.000
461     92 101 1.000
462     92 102 1.000
463     92 103 1.000
464     92 111 1.000
465     92 114 1.000
466     92 115 1.000
467     92 118 1.000
468     92 119 1.000
469     93 94 1.000
470     93 95 1.000
471     93 100 1.000
472     93 101 1.000
473     93 102 1.000
474     93 103 1.000
475     93 118 1.000
476     94 95 1.000
477     94 96 1.000
478     94 100 1.000
479     94 101 1.000
480     94 118 1.000
481     94 119 1.000
482     94 121 1.000
483     94 122 1.000
484     95 96 1.000
485     95 100 1.000
486     95 101 1.000
487     96 97 1.000
488     96 98 1.000
489     96 99 1.000
490     96 100 1.000
491     96 101 1.000
492     96 122 1.000
493     96 125 1.000
494     96 126 1.000
495     96 130 1.000
496     97 98 1.000
497     97 99 1.000
498     97 125 1.000
499     97 126 1.000
500     97 129 1.000
501     97 130 1.000
502     98 99 1.000
503     98 130 1.000
504     99 100 1.000
505     99 101 1.000
506     99 125 1.000
507     99 130 1.000
508     100 101 1.000
509     100 102 1.000
510     101 102 1.000
511     101 103 1.000
512     101 118 1.000
513     101 121 1.000
514     101 122 1.000
515     101 125 1.000
516     102 103 1.000
517     102 104 1.000
518     102 118 1.000
519     103 104 1.000
520     103 105 1.000
521     103 114 1.000
522     103 117 1.000
523     103 118 1.000
524     104 105 1.000
525     104 106 1.000
526     104 114 1.000
527     105 106 1.000
528     105 110 1.000
529     105 111 1.000
530     105 113 1.000
531     105 114 1.000
532     106 107 1.000
533     107 108 1.000
534     108 110 1.000
535     110 111 1.000
536     110 112 1.000
537     110 113 1.000
538     110 114 1.000
539     111 112 1.000
540     111 113 1.000
541     111 114 1.000
542     111 115 1.000
543     112 113 1.000
544     112 114 1.000
545     112 115 1.000
546     112 116 1.000
547     113 114 1.000
548     113 115 1.000
549     113 116 1.000
550     113 117 1.000
551     114 115 1.000
552     114 116 1.000
553     114 117 1.000
554     114 118 1.000
555     115 116 1.000
556     115 117 1.000
557     115 118 1.000
558     115 119 1.000
559     116 117 1.000
560     116 118 1.000
561     116 119 1.000
562     116 120 1.000
563     117 118 1.000
564     117 119 1.000
565     117 120 1.000
566     117 121 1.000
567     118 119 1.000
568     118 120 1.000
569     118 121 1.000
570     118 122 1.000
571     119 120 1.000
572     119 121 1.000
573     119 122 1.000
574     119 123 1.000
575     120 121 1.000
576     120 122 1.000
577     120 123 1.000
578     120 124 1.000
579     121 122 1.000
580     121 123 1.000
581     121 124 1.000
582     121 125 1.000
583     122 123 1.000
584     122 124 1.000
585     122 125 1.000
586     122 126 1.000
587     123 124 1.000
588     123 125 1.000
589     123 126 1.000
590     123 127 1.000
591     124 125 1.000
592     124 126 1.000
593     124 127 1.000
594     124 128 1.000
595     125 126 1.000
596     125 127 1.000
597     125 128 1.000
598     125 130 1.000
599     126 127 1.000
600     126 128 1.000
601     126 129 1.000
602     126 130 1.000
603     127 128 1.000
604     127 129 1.000
605     128 129 1.000
606     128 130 1.000
607     129 130 1.000