set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 0
res_num 1 0=1 145=146 , HBB_HORSE
res_secstru 0=_ 3=H 16=_ 18=H 46=_ 49=H 77=_ 79=H 95=_ 99=H , HBB_HORSE
res_chain 0=B , HBB_HORSE
accession_id PDB:1g0b_B , HBB_HORSE
#----------
open_3D HB-Beta-chain , HBB_HORSE
3D_render
# All atoms of amino acid 20
3D_select 20
3D_sticks on
# C-alpha of amino acid 20
3D_select 20.CA
3D_label "Hello world"
# Deleted commands: [load ]
#end_of_script_1378667370729_
| \/\/\/\/\/\/\ /\/\/\/\/\/\/\/\/\/\/\/\/\/\ \/\/\/\/\/\
|
| HBB_HORSE | VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKV |
| /\/\/\/\/\/\/\/\/ \/\/\/\/\/\/\/\/ \/\/\/\/\/\/\/\/\/\/\
|
| KAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGK |
| /\/\/\/\/\/\/\/\/\/\/\/\/\
|
| DFTPELQASYQKVVAGVANALAHKYH |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.