set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 0
res_num 1 0=1 55=57 273=275 , pdb1sbc.ent
res_secstru 0=_ 5=H 19=_ 25=E 32=_ 42=E 50=_ 61=H 73=_ 87=E 94=_ 101=H 116=_ 118=E 123=_ 130=H 145=_ 146=E 152=_ 218=H 237=_ 240=H 252=_ 267=H 273=_ , pdb1sbc.ent
res_chain 0=A , pdb1sbc.ent
accession_id PDB:1sbc_A , pdb1sbc.ent
#----------
new_selection pdb1sbc.ent/copied_from_selected , copied , 36-50
set_annotation pdb1sbc.ent/copied_from_selected , Color ,#5555FF
add_annotation pdb1sbc.ent/copied_from_selected , Atoms , .CA.CB.N*
add_annotation pdb1sbc.ent/copied_from_selected , 3D_view , 3D_spheres
add_annotation pdb1sbc.ent/copied_from_selected , Atoms , .CA.CB
add_annotation pdb1sbc.ent/copied_from_selected , 3D_view , 3D_color #FFffFF
add_annotation pdb1sbc.ent/copied_from_selected , Atoms , .N*
add_annotation pdb1sbc.ent/copied_from_selected , 3D_view , 3D_color #4455FF
# Deleted commands: [load ]
#end_of_script_1378667376295_
| \/\/\/\/\/\/\/ ======> =======>
|
| pdb1sbc | AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDG |
| \/\/\/\/\/\/ ======> \/\/\/\/\/\/\/\ ==
|
| NGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDV |
| ==> /\/\/\/\/\/\/\/ =====>
|
| INMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVD |
| /\/\/\/\/\/\/\/\/\/
|
| SNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNL |
| /\/\/\/\/\/\ \/\/\/
|
| SASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.