PredictBias

identification of genomic and pathogenicity islands in prokaryotic genome
Home | Help | Analyzed genomes
 
A) Input parameters
Genomeexample.gbkThreshold dinucleotide bias2
Threshold codon bias4Threshold %GC bias3
E-value (RPSBlast)0.05Genome (non-pathogenic)
 
B) Compare a potential GI or PAI in related non-pathogenic sp. (phylogenetic tree)
Potential GI or PAI start    end  
Select Organism     
 
C) Potential GIs and PAIs in BA000033 (download)
S.NoStartEndBiasVirulenceInsertion elementsPrediction
YYY
0133.092223DNA gyrase subunit B
1132.903846DNA gyrase subunit A
-1112.564726conserved hypothetical protein
-1111.900030histidine ammonia-lyase
-1121.602921seryl-tRNA synthetase
0131.468499conserved hypothetical protein
1131.973569Conserved hypothetical protein
2132.196956conserved hypothetical protein
4152.260885conserved hypothetical protein
5152.39349050S ribosomal protein L9
7162.353177replicative DNA helicase
7172.208672adenylosuccinate synthase
8181.692603**response regulator
4162.449058two-component sensor histidine kinase
2172.605299conserved hypothetical protein
0131.570729conserved hypothetical protein
-2121.128653conserved hypothetical protein
-3131.414030conserved hypothetical protein orfX
-2141.063373hypothetical protein
317-1.677698hypothetical protein
418-3.009117transposase for IS-like element
015-2.367567probable HMG-CoA synthase
-213-2.418036conserved hypothetical protein
-214-2.499095penicillin binding protein 2 prime
-112-3.135475truncated methicillin resistance protein MecR1
-112-2.946087hypothetical protein
-113-2.756512hypothetical protein
117-2.181993hypothetical protein
020-0.549394cassette chromosome recombinase B
220-0.338820cassette chromosome recombinase A
1211.319683hypothetical protein
0191.061016hypothetical protein
016-0.394781hypothetical protein
013-1.452190hypothetical protein
113-2.055944truncated hypothetical protein
315-2.401604hypothetical protein
417-4.207640truncated hypothetical protein
516-4.365266hypothetical protein
817-3.837710hypothetical protein
618-3.448261truncated transposase
618-3.616000truncated transposase
821-5.408713enterotoxin H
922-5.369111conserved hypothetical protein
721-5.742706conserved hypothetical protein
419-4.736351conserved hypothetical protein
621-4.691748conserved hypothetical protein
518-3.962201conserved hypothetical protein
413-2.023923conserved hypothetical protein
413-1.479371hypothetical protein
3120.069555hypothetical protein
1110.094930conserved hypothetical protein
1100.112773hypothetical protein
113-0.582554hypothetical protein
015-0.993074hypothetical protein
117-2.0305721-phosphatidylinositol phosphodiesterase
318-4.795962hypothetical protein
418-5.114928hypothetical protein
316-5.101639hypothetical protein
213-3.807653hypothetical protein
114-3.753014hypothetical protein
114-2.945449hypothetical protein
114-2.714097conserved hypothetical protein
115-2.538229hypothetical protein
316-2.801800IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR
617-2.346726iron-regulated ABC transporter siderophore
718-2.678270iron-regulated ABC transporter siderophore
818-3.333744iron-regulated ABC transporter
ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
Ser-Asp rich fibrinogen-binding bone sialoprotein-bindingIGASERPTASE582e-10 IgA-specific serine endopeptidase (S6) signature.
		>IGASERPTASE#IgA-specific serine endopeptidase (S6) signature.

		          Length = 1541

		

		 Score = 57.8 bits (139), Expect = 2e-10

		 Identities = 49/262 (18%), Positives = 93/262 (35%), Gaps = 7/262 (2%)

		

		Query: 48   QEAKAAENTSTENAKQDDATTSDNKEVVSEAENNSTTENDSTNPIKKETNTDSQPEAKEE 107

		            Q+A      + E AK+  +    N +    A++ S T+   T   K+    + + +AK E

		Sbjct: 1056 QDATETTAQNREVAKEAKSNVKANTQTNEVAQSGSETKETQTTETKETATVEKEEKAKVE 1115

		

		Query: 108  STKSSTQQQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTT 167

		                 T++ Q     T++  P+  + E V+P  +     D +V ++E ++  NT  D   

		Sbjct: 1116 -----TEKTQEVPKVTSQVSPKQEQSETVQPQAEPARENDPTVNIKEPQSQTNTTADTEQ 1170

		

		Query: 168  KPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKL 227

		                +    +    + +T    +     P       T  T   E  N  K   ++     

		Sbjct: 1171 PAKETSSNVEQPVTESTTVNTGNSVVENPENTTPATTQPTVNSESSNKPKN--RHRRSVR 1228

		

		Query: 228  KELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIK 287

		                  +  T  S      A   +     NA +  A A+   VA N    + +   Q   

		Sbjct: 1229 SVPHNVEPATTSSNDRSTVALCDLTSTNTNAVLSDARAKAQFVALNVGKAVSQHISQLEM 1288

		

		Query: 288  VGDGKDNVAAAHDGKDIEYDTE 309

		              +G+ NV  ++   +  Y + 

		Sbjct: 1289 NNEGQYNVWVSNTSMNKNYSSS 1310

		

		

		

		 Score = 32.7 bits (74), Expect = 0.011

		 Identities = 44/233 (18%), Positives = 76/233 (32%), Gaps = 28/233 (12%)

		

		Query: 47   NQEAKAAENTSTENAKQDDATTSDNKEVVSEAENNSTTENDSTNPIKKETNTDSQPEAKE 106

		            NQ       T+  N + D  +   N E ++  +           P +         E   

		Sbjct: 989  NQTVDTTNITTPNNIQADVPSVPSNNEEIARVDEAPVPPPAPATPSE-------TTETVA 1041

		

		Query: 107  ESTKSSTQQQQNNVTATTETKPQNIE-----KENVKPST-----DKTATEDTSVILEEKK 156

		            E++K  ++  + N    TET  QN E     K NVK +T      ++ +E       E K

		Sbjct: 1042 ENSKQESKTVEKNEQDATETTAQNREVAKEAKSNVKANTQTNEVAQSGSETKETQTTETK 1101

		

		Query: 157  APNNTNNDVTTKPSTSEIQTKPT----TPQESTNIENSQPQPTPSKVDNQVTDATNPKEP 212

		                   +   K  T + Q  P        +    E  QPQ  P++ ++   +   P+  

		Sbjct: 1102 ETATVEKEEKAKVETEKTQEVPKVTSQVSPKQEQSETVQPQAEPARENDPTVNIKEPQSQ 1161

		

		Query: 213  -------VNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNA 258

		                      +KE   N  + + E    ++       P  T P +  P   + 

		Sbjct: 1162 TNTTADTEQPAKETSSNVEQPVTESTTVNTGNSVVENPENTTPATTQPTVNSE 1214
ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
Conserved hypothetical protein. 
ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
 Conserved hypothetical protein.

ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
 Conserved hypothetical protein.

ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
 Conserved hypothetical protein.

ORFs having significant similarity with Known Virulence factors
LocusTagHitsScoreE-valueComments
 Conserved hypothetical protein.

		Y	N	N		

		2	17	1.736697	acetoinreductase

		2	17	1.679402	hypothetical protein

		1	18	2.092355	superoxide dismutase

		-2	10	1.765974	hypothetical protein

		-1	9	2.722936	purine nucleoside phosphorylase

		0	10	3.083557	deoxyribose-phosphate aldolase

		0	11	2.863055	phosphopentomutase

		1	15	3.276420	hypothetical protein

		2	16	3.587904	truncated replication initiator protein

		2	16	3.456300	truncated replication initiation protein

		2	17	3.812989	alcohol-acetaldehyde dehydrogenase

		1	15	2.984935	truncated capsular polysaccharide synthesis

		0	14	2.354534	capsular polysaccharide synthesis enzyme Cap8B

		-1	13	3.148857	capsular polysaccharide synthesis enzyme Cap8C

		-1	14	2.278338	capsular polysaccharide synthesis enzyme Cap8D

		-2	13	1.053012	capsular polysaccharide synthesis enzyme Cap8E

		-2	11	0.526159	capsular polysaccharide synthesis enzyme Cap8F

		-2	11	0.726038	capsular polysaccharide synthesis enzyme Cap8G

		-1	12	0.057409	capsular polysaccharide synthesis enzyme Cap8H

		1	12	-1.435756	capsular polysaccharide synthesis enzyme Cap8I

		1	12	-1.113055	capsular polysaccharide synthesis enzyme Cap8J

		2	11	-0.691918	capsular polysaccharide synthesis enzyme Cap8K

		3	10	-0.585988	capsular polysaccharide synthesis enzyme Cap8L

		3	10	-0.052354	capsular polysaccharide synthesis enzyme Cap8M

		3	11	0.395108	capsular polysaccharide synthesis enzyme Cap8N

		3	15	1.882955	capsular polysaccharide synthesis enzyme Cap8O

		Y	N	N		

		3	15	1.016755	hypothetical protein

		0	14	1.801021	conserved hypothetical protein

		-1	14	1.776764	hypothetical protein

		-2	11	1.779395	L-lactate dehydrogenase

		-2	11	1.109025	probable PTS galactitol-specific enzyme IIC

		0	15	1.306785	sorbitol dehydrogenase

		2	14	1.218073	hypothetical protein

		2	14	1.258011	conserved hypotheticl protein

		2	13	1.321262	cell division and morphogenesis-related protein

		2	14	1.677785	two-component sensor histidine kinase

		3	13	2.003900	two-component response regulator

		2	15	2.876230	holin-like protein LrgA

		2	15	2.388894	holin-like protein LrgB

		1	16	2.338276	6-phospho-beta-glucosidase

		0	15	2.612834	conserved hypothetical protein

		-1	17	2.724795	probable ribokinase

		-1	15	2.715891	ribose permease

		-1	15	2.705267	truncated NADH dehydrogenase subunit

		1	13	3.642087	hypothetical protein

		1	12	3.411569	peptidoglycan hydrolase

		0	14	3.178345	conserved hypothetical protein

		0	16	1.576820	hypothetical protein

		-1	15	1.025343	hypothetical protein

		-1	15	0.222126	hypothetical protein

		1	16	-1.098219	conserved hypothetical protein

		0	15	-1.520013	hypothetical protein

		0	15	-1.543808	conserved hypothetical protein

		1	19	-1.964348	conserved hypothetical protein

		1	20	-4.713022	hypothetical protein

		2	20	-5.619249	hypothetical protein

		3	21	-6.411078	hypothetical protein

		3	20	-6.720697	hypothetical protein

		4	19	-7.660367	hypothetical protein

		0	14	-5.170859	hypothetical protein

		Y	N	N		

		2	14	0.158203	hypothetical protein

		0	14	-0.530871	hypothetical protein

		1	15	-1.520013	hypothetical protein

		2	17	-1.282618	conserved hypothetical protein

		3	16	-2.056242	hypothetical protein

		6	19	-4.776997	hypothetical protein

		6	20	-4.768607	conserved hypothetical protein

		10	22	-4.429470	NADH dehydrogenase subunit 5

		11	22	-3.921695	conserved hypothetical protein

		12	21	-4.088029	conserved hypothetical protein

		12	22	-3.602760	conserved hypothetical protein

		11	20	-3.963105	hypothetical protein

		9	19	-3.741722	cystathionine gamma-synthase

		3	15	-2.686819	hypothetical protein

		Y	N	N		

		-1	12	3.250670	conserved hypothetical protein

		0	10	3.704233	conserved hypothetical protein

		-1	10	3.673847	conserved hypothetical protein

		-1	10	3.749513	conserved hypothetical protein

		1	13	3.769483	methionyl-tRNA synthetase

		1	15	3.604577	conserved hypothetical protein

		Y	N	N		

		1	17	-3.160266	Ser-Asp rich fibrinogen-binding bone

		4	17	-3.183989	Ser-Asp rich fibrinogen-binding bone

		2	15	-2.540411	conserved hypothetical protein

		-1	15	-2.002231	conserved hypothetical protein

		0	15	-2.105152	conserved hypothetical protein

		1	18	-2.060927	probable glucosamine-6-phosphate isomerase

		-1	12	-2.019557	conserved hypothetical protein

		2	14	-3.122979	hypothetical protein

		1	16	-0.639033	acetyl-CoA c-acetyltransferase

		0	19	-0.037936	hypothetical protein

		0	18	0.782123	hypothetical protein

		0	17	1.921752	hypothetical protein

		0	16	2.358886	uracil-DNA glycosylase

		2	20	4.483346	hypothetical protein

		2	20	3.333168	conserved hypothetical protein

		2	18	2.903933	conserved hypothetical protein

		2	19	2.548076	conserved hypothetical protein

		Y	N	N		

		6	19	-3.265082	hypothetical protein

		4	17	-3.165818	hypothetical protein

		3	15	-4.041738	conserved hypothetical protein

		4	16	-3.902529	conserved hypothetical protein

		6	18	-4.803129	conserved hypothetical protein

		5	18	-4.380909	conserved hypothetical protein

		6	18	-5.609334	conserved hypothetical protein

		4	19	-4.334180	conserved hypothetical protein

		3	16	-1.999281	conserved hypothetical protein

		Y	N	N		

		1	15	-3.725435	conserved hypothetical protein

		1	13	-1.513361	arginyl-tRNA synthetase

		2	12	-1.949857	hypothetical protein

		1	13	-1.968698	hypothetical protein

		3	9	-1.460233	staphylococcal accessory regulator A

		3	10	-1.028348	conserved hypothetical protein

		4	10	-1.319841	hypothetical protein

		9	14	-3.322016	hypothetical protein

		8	14	-2.846423	conserved hypothetical protein

		9	13	-2.890184	conserved hypothetical protein

		9	17	-3.716207	conserved hypothetical protein

		11	17	-3.866250	hypothetical protein

		10	17	-3.742248	teichoic acid biosynthesis protein

		10	18	-3.516844	teichoic acid translocation ATP-binding protein

		9	17	-3.652806	teichoic acid translocation permease protein

		3	14	-1.528067	teichoic acid biosynthesis protein B

		0	14	0.497519	teichoic acid biosynthesis protein X

		2	17	3.385944	teichoic acid biosynthesis protein D

		2	16	3.714907	penicillin binding protein 4

		3	17	3.609899	ATP-binding cassette transporter A

		2	16	3.493097	hypothetical protein

		3	17	3.605140	conserved hypothetical protein

		0	15	3.056193	iron-hydroxamate transport ATP-binding protein

		Y	N	N		

		2	13	0.923069	ABC transporter permease

		1	14	0.117138	conserved hypothetical protein

		-1	12	2.410037	conserved hypothetical protein

		-1	11	2.870711	hypothetical protein

		-2	10	3.051844	conserved hypothetical protein

		-2	12	3.300421	conserved hypothetical protein

		-2	13	3.444103	conserved hypothetical protein

		-2	14	3.754832	conserved hypothetical protein

		-2	15	3.015311	conserved hypothetical protein

		Y	N	N		

		4	22	1.070752	phosphoglycerate kinase

		9	32	2.633627	triosephosphate isomerase

		6	27	2.604629	2,

		2	29	3.562848	enolase

		3	30	3.153671	hypothetical protein

		3	28	3.047330	probable protein-export membrane protein

		3	28	3.056313	ribonuclease R

		4	29	3.187593	ssrA-binding protein

		4	34	3.847840	hypothetical protein

		4	42	4.208017	hypothetical protein

		3	40	4.619828	hypothetical protein

		1	36	4.088528	hypothetical protein

		1	32	3.633471	hypothetical protein

		-1	23	2.660232	hypothetical protein

		0	15	1.671924	putative primase

		2	12	0.689562	hypothetical protein

		2	12	0.614817	hypothetical protein

		1	11	0.446900	hypothetical protein

		1	12	-0.375087	hypothetical protein

		-1	12	0.127697	hypothetical protein

		-3	12	-0.230993	hypothetical protein

		-1	14	-1.040419	Ear

		1	15	0.002552	ENTEROTOXIN TYPE C PRECURSOR

		2	18	0.208295	extracellular enterotoxin L

		4	19	0.858195	conserved hypothetical protein

		3	17	0.365835	hypothetical protein

		3	17	0.017711	conserved hypothetical protein

		3	17	0.204141	fibrinogen-binding protein

		Y	N	N		

		4	17	-4.314875	DltB membrane protein

		6	19	-5.251773	D-alanyl carrier protein

		8	20	-7.879333	poly D-alanine transfer protein

		6	20	-7.555233	conserved hypothetical protein

		4	23	-7.057270	conserved hypothetical protein

		3	20	-7.856881	conserved hypothetical protein

		4	17	-7.912614	probable cytosol aminopeptidase

		4	18	-7.793069	conserved hypothetical protein

		2	15	-5.668499	conserved hypothetical protein

		0	15	-4.402201	hypothetical protein

		-1	13	-3.728315	Na+/H+ antiporter subunit

		Y	N	N		

		1	14	-3.239470	conserved hypothetical protein

		-1	13	-3.795189	type-I signal peptidase

		-1	13	-3.713857	type-1 signal peptidase 1B

		-1	14	-4.211591	conserved hypothetical protein

		-2	14	-4.313608	coenzyme A disulfide reductase

		-3	15	-3.476195	conserved hypothetical protein

		-1	13	-2.436249	conserved hypothetical protein

		0	13	-2.029723	hypothetical protein

		1	16	-1.939684	conserved hypothetical protein

		1	13	-1.376675	hypothetical protein

		1	12	-1.877332	conserved hypothetical protein

		2	12	-1.646879	hypothetical protein

		Y	N	N		

		0	10	-3.130774	conserved hypothetical protein

		1	12	-4.112803	hypothetical protein

		1	12	-4.276700	large-conductance mechanosensitive channel

		4	18	-6.444273	glycine betaine transporter

		4	20	-6.146721	aconitate hydratase

		5	18	-4.016713	conserved hypothetical protein

		3	15	-0.815259	conserved hypothetical protein

		2	13	1.325549	conserved hypothetical protein

		Y	N	Y		

		-2	17	-3.691075	truncated transposase

		-3	19	-3.119877	branched-chain amino acid carrier protein

		-2	19	-4.254720	conserved hypothetical protein

		0	16	-5.806637	conserved hypothetical protein

		1	17	-5.644169	dihydrolipoamide succinyltransferase

		0	17	-5.483360	oxoglutarate dehydrogenase

		0	15	-5.503081	putative protein histidine kinase ArlS

		2	16	-6.614160	truncated (putative response regulator ArlR

		2	17	-6.416750	conserved hypothetcial protein

		1	18	-5.857990	undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc

		0	15	-4.514748	conserved hypothetical protein

		0	14	-4.423416	truncated transposase

		2	15	-4.373073	probable carboxy-terminal processing proteinase

		1	13	-3.565036	conserved hypothetical protein

		3	17	-0.618276	PTS system glucose-specific enzyme II A

		Y	N	N		

		5	16	-0.686303	hypothetical protein

		5	15	-0.613241	hypothetical protein

		5	15	-1.329578	hypothetical protein

		5	14	-1.695708	hypothetical protein

		4	13	-1.693546	hypothetical protein

		1	13	-2.609710	hypothetical protein

		-1	14	-3.206491	hypothetical protein

		-1	15	-3.488543	hypothetical protein

		Y	N	Y		

		2	12	2.096342	phage repressor

		1	11	2.199829	hypothetical protein

		0	12	-0.036164	hypothetical protein

		-4	16	-0.781178	hypothetical protein

		-2	14	-3.422530	hypothetical protein

		-2	14	-3.969653	hypothetical protein

		1	16	-4.504473	integrase

		2	16	-4.235145	hypothetical protein

		1	15	-4.254501	hypothetical protein

		-1	16	-3.049974	staphylococcal respiratory response protein

		-1	17	-2.561537	staphylococcal respiratory response protein

		2	18	-2.763703	ribosomal large subunit pseudouridine synthase

		1	17	-2.455749	conserved hypothetical protein

		0	17	-2.644103	conserved hypothetical protein

		2	17	-2.724435	conserved hypothetical protein

		0	14	-2.750715	site-specific recombinase

		0	13	-1.836187	conserved hypothetical protein

		1	11	-0.551171	conserved hypothetical protein

		1	11	-0.413900	hypothetical protein

		1	11	-0.162547	conserved hypothetical protein

		1	13	0.125697	glucose-6-phosphate 1-dehydrogenase

		2	14	0.138205	alpha-D-1,4-glucosidase

		2	18	0.370035	maltose operon transcriptional repressor

		Y	N	N		

		2	11	-0.381269	conserved hypothetical protein

		1	11	-0.403028	shikimate dehydrogenease

		1	11	-0.321973	conserved hypothetical protein

		1	12	-0.518760	conserved hypothetical protein

		0	14	0.575708	5'-methylthioadenosine

		2	14	0.873868	hypothetical protein

		0	11	-0.693005	conserved hypothetical protein

		0	11	-1.113862	conserved hypothetical protein

		-1	10	-0.999724	conserved hypothetical protein

		-2	8	-0.423443	conserved hypothetical protein

		-2	8	0.001952	conserved hypothetical protein

		-1	8	-0.913720	transcription elongation factor

		1	10	-1.180108	uridine kinase

		2	11	-1.659011	conserved hypothetical protein

		2	10	-1.028699	conserved hypothetical protein

		2	10	-0.959359	conserved hypothetical protein

		2	10	-1.692209	alanyl-tRNA synthetase

		1	9	-0.652108	conserved hypothetical protein

		0	8	0.949503	(5-methylaminomethyl-2-thiouridylate)-

		2	9	1.207903	conserved hypothetical protein

		2	12	1.118829	hypothetical protein

		5	15	1.241362	sigmaB-controlled gene product

		3	18	1.897489	conserved hypothetical protein

		5	19	1.404238	conserved hypothetical protein

		4	21	0.664639	conserved hypothetical protein

		Y	N	N		

		2	19	-1.591719	citrate synthase II

		3	18	-2.925932	D-serine/D-alanine/glycine TRANSPORTER

		8	25	-9.452164	pyruvate kinase

		9	22	-7.499503	6-phosphofructokinase

		10	22	-7.470925	acetyl-CoA carboxylase carboxyl transferase

		9	22	-6.923872	acetyl-CoA carboxylase transferase beta subunit

		8	21	-6.421337	DNA POLYMERASE III ALPHA SUBUNIT

		3	19	-2.730240	conserved hypothetical protein

		3	19	-3.094437	conserved hypothetical protein

		2	15	-2.519162	conserved hypothetical protein

		2	15	-3.139983	conserved hypothetical protein

		1	15	-3.292334	alanine dehydrogenase

		-1	15	-3.931299	conserved hypothetical protein

		-1	16	-4.683665	conserved hypothetical protein

		-1	16	-4.493099	conserved hypothetical protein

		-2	16	-5.347732	conserved hypothetical protein

		-2	15	-4.756804	30S ribosomal protein S4

		-2	13	-4.458613	conserved hypothetical protein

		-1	14	-3.050633	D-3-phosphoglycerate dehydrogenase

		Y	N	N		

		4	12	-2.362208	hypothetical protein

		3	13	-2.396575	conserved hypothetical protein

		4	15	-4.099555	conserved hypothetical protein

		3	13	-2.676945	leucyl-tRNA synthetase

		2	9	-1.338137	conserved hypothetical protein

		2	10	-1.139221	conserved hypothetical protein

		2	13	0.926231	repressor of toxins Rot

		2	13	1.315286	6,7-dimethyl-8-ribityllumazine synthase

		2	13	1.533246	riboflavin biosynthesis protein

		Y	N	N		

		2	15	-0.162547	conserved hypothetical protein

		1	13	-0.135816	conserved hypothetical protein

		0	12	0.245284	conserved hypothetical protein

		-1	12	0.706223	conserved hypothetical protein

		-1	12	0.399526	aminopeptidase ampS

		-3	12	0.292343	conserved hypothetical protein

		-1	12	0.476875	hypothetical protein

		1	14	0.396296	two-component response regulator

		9	12	2.288024	two-component sensor histidine kinase

		9	12	2.197362	conserved hypothetical protein

		9	11	2.175748	hypothetical protein

		9	11	2.267365	methionyl aminopeptidase map

		9	11	2.226571	conserved hypothetical protein

		8	11	2.177525	hypothetical protein

		Y	N	Y		

		2	14	-2.620209	hypothetical protein

		1	13	-1.444598	hypothetical protein

		1	13	-1.190447	hypothetical protein

		1	13	-1.051756	hypothetical protein

		2	13	-1.297812	hypothetical protein

		1	14	-0.781916	hypothetical protein

		2	14	-0.162547	hypothetical protein

		4	16	0.300416	hypothetical protein

		4	17	0.390062	capsid protein

		3	16	-0.403593	hypothetical protein

		3	17	-0.595447	portal protein

		4	15	1.148635	hypothetical protein

		5	15	1.200193	hypothetical protein

		5	15	1.146867	hypothetical protein

		5	14	1.260339	hypothetical protein

		5	13	1.755756	hypothetical protein

		6	14	2.124454	hypothetical protein

		6	17	-0.473710	hypothetical protein

		5	15	-0.401781	hypothetical protein

		3	16	-1.033193	hypothetical protein

		5	14	-2.133873	hypothetical protein

		4	12	-1.594186	hypothetical protein

		4	13	-1.293727	hypothetical protein

		3	13	-1.170981	hypothetical protein

		3	13	-1.346518	hypothetical protein

		3	16	-1.526946	single-strand DNA-binding protein

		5	21	-1.246861	hypothetical protein

		6	23	-1.369603	hypothetical protein

		4	23	-1.951521	hypothetical protein

		3	17	-0.203522	hypothetical protein

		3	17	-0.204449	hypothetical protein

		3	15	-0.338914	hypothetical protein

		1	16	0.017471	hypothetical protein

		2	15	0.107238	hypothetical protein

		3	16	0.454737	hypothetical protein

		8	27	-2.429549	hypothetical protein

		4	24	-1.414194	phage anti repressor

		4	27	-0.500613	hypothetical protein

		3	26	-1.346347	hypothetical protein

		3	29	-1.366602	hypothetical protein

		1	27	-1.500746	phage repressor

		2	26	-0.101941	staphylococcal enterotoxin Q

		3	28	0.672685	staphylococcal enterotoxin Sek

		1	30	1.394424	integrase

		5	30	2.055327	truncated beta-hemplysin

		4	29	1.779201	hypothetical protein

		3	21	1.497970	hydroxamate siderophore binding lipoprotein

		4	20	1.239191	hypothetical perotein

		4	17	1.227261	truncated hypothetical protein

		5	17	0.592089	GroEL protein

		5	17	0.517278	GroES protein

		4	17	0.895654	conserved hypothetical protein

		4	18	0.084106	conserved hypothetical protein

		4	19	-0.282739	hypothetical protein

		6	24	-2.168446	delta-hemolysin

		4	28	-1.049746	accessory gene regulator B

		3	26	-1.360151	AgrD

		4	23	-1.844228	AgrC

		2	23	-0.772641	accessory gene regulator A

		1	22	-0.953842	sucrose-6-phosphate hydrolase

		2	23	-0.698609	sucrose operon repressor

		3	24	-0.842819	probabale ammonium transporter

		3	23	-3.093430	conserved hypothetical protein

		3	23	-3.697900	conserved hypothetical protein

		2	18	-4.374883	conserved hypothetical protein

		2	15	-4.180491	hypothetical ABC transporter ATP-binding

		0	11	-3.271195	conserved hypothetical protein

		0	11	-2.929789	dihydroxy-acid dehydratase

		0	10	-2.001341	acetolactate synthase large subunit

		-1	10	-1.608513	alpha-keto-beta-hydroxylacil reductoisomerase

		1	10	-0.971519	2-isopropylmalate synthase

		1	10	-0.758139	3-isopropylmalate dehydrogenase

		1	11	-0.667597	3-isopropylmalate dehydratase large subunit

		1	12	-0.600465	3-isopropylmalate dehydratase small subunit

		2	12	-0.949094	thereonine dehydratase

		Y	N	N		

		1	16	-4.715088	ATP synthase C chain

		1	22	-6.157525	ATP synthase A chain

		1	21	-5.250555	hypothetical protein

		1	20	-4.256114	UDP-GlcNAc 2-epimerase

		0	17	-4.005621	uracil phosphoribosyl transferase

		1	13	-2.418885	serine hydroxymethyl transferase

		2	15	-2.524751	conserved hypothetical protein

		-1	12	-2.649458	conserved hypothetical protein

		0	14	-2.886095	peptide chain release factor 1

		-1	11	-3.101322	thymidine kinase

		Y	N	Y		

		-2	12	-3.234869	conserved hypothetical protein

		-1	11	-2.794126	conserved hypothetoical protein

		-1	11	-3.244042	arginase

		0	15	-4.532581	******hypothetical protein

		-1	15	-4.375613	conserved hypotehtical protein

		-1	15	-3.603923	conserved hypothetical protein

		2	17	-1.766825	conserved hypotehtical protein

		2	17	-2.196975	conserved hypothetical protein

		0	15	-1.817180	conserved hypothetical protein

		-1	11	-0.863733	hypothetical protein

		0	12	-0.883824	alkaline shock protein 23

		-1	12	-0.664555	hypothetical protein

		0	12	-1.248323	hypothetical protein

		-1	14	-1.681038	conserved hypothetical protein

		-2	15	-2.986652	6-phospho-beta-galactosidase

		-1	15	-3.037601	PTS system lactose-specific IIBC component

		Y	N	N		

		-1	19	-3.297595	probable glycine betaine/carnitine/choline ABC

		-1	15	-4.422709	glycine betaine/carnitine/choline ABC

		1	13	-3.639029	conserved hypothetical protein

		2	14	-3.980608	conserved hypotehtical protein

		2	16	-3.043619	conserved hypothetical protein

		3	14	-2.856847	hypothetical protein

		3	15	-1.720890	conserved hypothetical protein

		1	16	-0.162547	hypothetical protein

		0	14	-1.351843	hypothetical protein

		0	13	0.883906	oligopeptide transporter putative ATPase domain

		0	14	1.080793	oligopeptide transporter putative ATPase domain

		0	14	1.534795	oligopeptide transporter putative membrane

		0	13	1.953855	oligopeptide transporter putative membrane

		-1	14	2.080480	oligopeptide transporter putative substrate

		0	15	3.257976	conserved hypothetical protein

		-2	14	2.874127	conserved hypothetical protein

		0	18	3.269179	hypothetical protein

		1	18	2.251940	conserved hypothetical protein

		0	18	1.343129	hypothetical protein

		-2	12	1.327211	hypothetical protein

		-1	10	0.856292	hypothetical protein

		-1	10	0.123671	hypothetical protein

		0	14	-1.097640	hypothetical protein

		1	13	-1.267214	hypothetical protein

		2	15	-2.110395	hypothetical protein

		-1	17	-3.118595	hypothetical protein

		3	21	-3.830142	hypothetical protein

		4	22	-3.671319	conserved hypothetical protein

		5	26	-4.271228	hypothetical protein

		6	27	-5.025126	hypothetical protein

		10	21	-7.800268	hypothetical protein

		9	19	-7.422310	conserved hypothetical protein

		6	12	-4.871246	UTP-glucose-1-phosphate uridyltransferase

		4	11	-4.538779	hypothetical protein

		4	12	-4.271663	gluconate permease

		2	11	-3.738324	gluconokinase

		-2	11	0.423807	gluconate operon transcriptional repressor

		-1	13	1.150128	conserved hypothetical protein

		1	12	-1.010236	conserved hypothetical protein

		-1	13	-2.225253	hypothetical protein

		0	12	-3.071736	fructose-bisphosphatase

		0	11	-3.753555	hypothetical protein

		-1	12	-3.036909	conserved hypothetical protein

		-1	10	-3.391849	conserved hypothetical protein

		-1	11	-3.885147	conserved hypothetical protein

		0	10	-4.459370	conserved hypothetical protein

		0	10	-4.280785	conserved hypothetical protein

		0	11	-4.181238	D-specific D-2-hydroxyacid dehydrogenase

		0	11	-4.689910	conserved hypothetical protein

		0	10	-3.962764	conserved hypothetical protein

		0	11	-3.927128	sortase

		2	15	-3.203381	hypothetical protein

		2	13	-2.905818	hypothetical protein

		Y	N	N		

		2	11	-2.590994	hypothetical protein

		3	9	-2.623622	hypothetical protein

		2	9	-3.057902	1-pyrroline-5-carboxylate dehydrogenase

		3	10	-2.856295	hypothetical protein

		3	8	-2.493083	copper-transporting ATPase copA

		2	10	-2.430411	squalene synthase

		Y	N	N		

		0	15	-3.299802	conserved hypothetical protein

		0	13	-3.104517	hypothetical protein

		0	11	-3.486517	Drp35

		0	11	-4.621611	conserved hypotehtical protein

		0	11	-5.083906	pyrrolidone-carboxylate peptidase

		2	11	-4.624121	hypothetical protein

		2	12	-4.199288	collagen adhesin precursor

		0	14	-4.829213	hypothetical protein

		2	16	-4.216601	hypothetical protein

		0	13	-2.661127	conserved hypothetical protein

		0	14	-2.174041	hypothetical protein

		0	14	-3.754609	cold shock protein cspB

		1	15	-3.898406	hypothetical protein

		1	15	-3.764019	hypothetical protein

		0	14	-4.198421	glucose inhibited division protein B

		4	16	-5.978011	glucose inhibited division protein A

		1	15	-5.194569	possible thiophene and furan oxidation protein

		2	18	-2.346907	ribonuclease P protein component

		2	17	-2.211202	50S ribosomal protein L34

		3	17	-1.859675	

		Y	N	N		

		3	15	3.109590	

		3	15	3.362258	

		1	18	1.232802	

		0	17	1.216032	

		-2	17	1.490346	

		2	14	-0.268367	

		2	13	0.232320	

		2	11	0.195327	

		1	12	-0.003690	

		1	12	0.285011	

		1	13	0.259627	

		-1	16	0.232710	

		-1	18	-0.185161	

		0	22	-0.464579	

		0	22	-0.382025	

		3	26	-3.661201	

		4	27	-4.799467	

		7	30	-4.677436	

		7	29	-3.866250	

		7	30	-3.304187	

		5	26	-3.332119	

		2	26	0.399251	

		1	26	1.589695	

		0	24	1.414514	

		0	19	0.779738	

		3	19	-0.749472	

		3	21	-0.583726	

		4	19	-0.966590	

		5	20	-1.349490	

		5	21	-1.657777	

		7	22	-2.833665	

		6	30	-2.795600	

		5	31	-3.013041	

		3	25	-1.747692	

		3	24	-1.941356	

		4	22	-2.102372	

		4	23	-0.966329	

		4	20	-0.891144	

		3	20	-1.963523	

		6	23	-3.757017	

		4	23	-3.759669	

		4	21	-3.081240	

		4	17	-3.196408	

		3	16	-3.575643	

		1	14	-2.473114	

		0	12	-2.494714	

		1	12	-2.987117	

		2	14	-3.763176	

		2	15	-4.085132	

		2	18	-4.598107	

		3	19	-5.184192	

		4	20	-4.774075	

		5	23	-4.219756	

		0	23	-3.349129	

		0	12	0.596307	

		1	12	2.003518	

		-2	12	0.757787	

		-1	11	1.584854	

		0	12	1.337453	

		-1	11	0.927884	

		4	13	-0.814097	

		3	13	-1.474500	

		3	13	-0.845723	

		-2	11	-4.279862	

		0	10	-4.232954	

		-2	12	-3.390893	

		Y	N	N		

		2	13	-2.412772	

		3	16	-3.320441	

		2	16	-3.681065	

		3	20	-5.629638	

		4	33	-4.230343	

		2	22	-1.907432	

		1	19	-0.517629	

		-1	12	0.637247	

		-1	13	0.122354	

		-1	13	0.907176	

		-2	11	0.634704	

		-2	13	0.815270	

		-1	14	0.659638	

		2	10	1.035139	

		8	12	1.519519	

		8	13	1.359889	

		10	15	1.247028	

		9	14	1.133035	

		9	15	1.015772	

		6	15	0.860300	

		1	13	-0.085812	

		2	15	-0.837023	

		3	15	-0.906964	

		4	14	-1.176231	

		3	12	-1.259675	

		2	13	-1.879665	

		Y	N	N		

		2	18	2.356432	

		4	21	1.948401	

		0	16	0.904414	

		0	13	1.339220	

		-1	12	1.172729	

		-1	11	0.840143	

		-2	11	0.511953	

		-1	15	1.009142	

		2	18	2.082842	

		5	25	2.275663	

		10	36	2.375947	

		7	27	2.111875	

		3	24	2.246694	

		4	22	2.141900	

		4	21	1.702738	

		4	23	2.762499	

		3	23	2.875724	

		6	28	2.826584	

		8	37	3.394112	

		8	39	3.166163	

		8	41	2.730834	

		8	40	1.418650	

		8	44	2.264018	

		10	43	1.716066	

		11	42	1.891166	

		12	40	2.630749	

		11	42	3.683607	

		11	41	4.189063	

		12	37	3.641801	

		9	40	5.309016	

		9	41	5.275306	

		7	42	5.067510	

		7	40	5.018971	

		6	39	5.063584	

		4	34	3.971820	

		2	25	2.561946	

		Y	N	N		

		0	16	-3.551925	

		1	12	-2.611149	

		1	11	-2.341360	

		1	11	-2.181180	

		2	11	-1.910588	

		1	9	-1.073143	

		3	11	0.082752	

		1	11	-0.907228	

		2	13	0.206185	

		1	13	-0.227104	

		0	12	-0.122240	

		0	11	0.398267	

		0	11	-0.237201	

		-1	9	0.976006	

		-2	10	1.157775	

		-1	11	2.135699	

		0	9	3.207256	

		-2	7	2.730535	

		-2	9	3.450299	

		Y	N	N		

		2	15	-2.346578	

		2	16	-1.670842	

		2	14	-1.235154	

		-1	16	-1.510064	

		0	18	-1.505877	

		4	19	-1.631473	

		7	18	-4.250266	

		8	18	-4.275436	

		5	16	-3.323583	

		3	16	-3.240823	

		1	15	-3.175640	

		1	15	-3.501043	

		-1	15	-1.825598	

		4	19	1.654018	

		7	25	1.288071	

		7	25	0.354918	

		7	21	0.848764	

		7	18	1.577788	

		7	18	2.511474	

		3	12	1.042123	

		Y	N	N		

		6	13	2.447936	

		8	14	2.807136	

		8	13	2.766912	

		9	13	2.787764	

		9	14	2.964214	

		11	15	3.801145	

		Y	N	N		

		2	13	0.740756	

		1	11	1.673347	

		2	12	1.509741	

		2	14	1.407912	

		2	14	1.207903	

		1	13	1.465083	

		2	13	1.460425	

		2	12	-0.265111	



	
 

	

        	
                	Contact Sachin Pundhir for Bugs/Comments.
For best view 1024 x 768 resolution & IE 6.0 or above recommended.