PredictBias

identification of genomic and pathogenicity islands in prokaryotic genome

Home \| Help \| Analyzed genomes

A) Input parameters
Genome	pro.txt	Threshold dinucleotide bias	2
Threshold codon bias	4	Threshold %GC bias	3
E-value (RPSBlast)	0.05	Genome (non-pathogenic)

B) Compare a potential GI or PAI in related non-pathogenic sp. (phylogenetic tree)
Potential GI or PAI start end
Select Organism

C) Potential GIs and PAIs in NC_000913 (download)

S.No

Start

End

Bias

Virulence

Insertion elements

Prediction

b0058

b0065

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b0058	-2	18	3.762670	dual specificity 23S rRNA pseudouridine(746),
b0059	-2	18	3.605486	RNA polymerase remodeling/recycling factor
b0060	-2	15	3.652647	DNA polymerase II
b0061	-1	15	3.882607	L-ribulose-5-phosphate 4-epimerase
b0062	-1	17	4.526688	L-arabinose isomerase
b0063	1	16	4.264041	L-ribulokinase
b0064	0	16	3.464049	ara regulon transcriptional activator;
b0065	1	17	3.688945	DedA family inner membrane protein

b0110

b0115

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0110	2	27	1.728944	1,6-anhydro-N-acetylmuramyl-L-alanine amidase,
b0111	3	33	1.632129	ampicillin resistance inner membrane protein;
b0112	3	29	1.830378	aromatic amino acid transporter
b0113	4	32	2.464613	pyruvate dehydrogenase complex repressor;
b0114	3	34	2.282339	pyruvate dehydrogenase, decarboxylase component
b0115	2	26	1.897232	pyruvate dehydrogenase,

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0115	RTXTOXIND	26	0.004	Gram-negative bacterial RTX secretion protein D signat...
>RTXTOXIND#Gram-negative bacterial RTX secretion protein D signature. Length = 478 Score = 25.9 bits (57), Expect = 0.004 Identities = 7/22 (31%), Positives = 12/22 (54%) Query: 17 ITEILVKVGDKVEAEQSLITVE 38 + EI+VK G+ V L+ + Sbjct: 107 VKEIIVKEGESVRKGDVLLKLT 128

b0130

b0153

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0130	-1	16	-3.084548	putative polysaccharide deacetylase lipoprotein
b0131	0	21	-4.203782	aspartate 1-decarboxylase
b0132	2	24	-5.189160	transposase_31 family protein
b0133	3	27	-6.082914	pantothenate synthetase
b0134	4	33	-7.987445	3-methyl-2-oxobutanoate
b0135	5	37	-9.267835	putative fimbrial-like adhesin protein
b0136	3	34	-8.557867	putative fimbrial-like adhesin protein
b0137	3	30	-7.775707	putative fimbrial-like adhesin protein
b0138	0	20	-5.045314	putative fimbrial-like adhesin protein
b0139	-1	18	-3.768313	putative outer membrane usher protein
b0140	-1	15	-0.633866	putative periplasmic pilin chaperone
b0141	-1	15	0.188713	putative fimbrial-like adhesin protein
b0142	-1	14	1.591817	2-amino-4-hydroxy-6-hydroxymethyldihyropteridine
b0143	0	13	3.034431	poly(A) polymerase
b0144	-1	14	2.942585	glutamyl-Q tRNA(Asp) synthetase
b0145	0	10	2.172596	transcriptional regulator of rRNA transcription;
b0146	0	11	2.489202	sugar fermentation stimulation protein A
b0147	-1	12	2.891584	2'-5' RNA ligase
b0148	-1	15	3.748510	putative ATP-dependent helicase
b0149	-2	15	3.489115	fused glycosyl transferase and transpeptidase
b0150	-1	14	3.301802	ferrichrome outer membrane transporter
b0151	1	16	4.376431	iron(3+)-hydroxamate import ABC transporter
b0152	1	15	4.052924	iron(3+)-hydroxamate import ABC transporter
b0153	0	14	3.856317	iron(3+)-hydroxamate import ABC transporter

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0152	FERRIBNDNGPP	75	7e-21	Ferrichrome-binding periplasmic protein signature.
>FERRIBNDNGPP#Ferrichrome-binding periplasmic protein signature. Length = 296 Score = 75.4 bits (185), Expect = 7e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWL 44 MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWL Sbjct: 1 MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWL 44

b0207

b0231

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b0207	-1	22	-3.089291	***2,5-diketo-D-gluconate reductase B
b0208	-2	25	-2.616306	LysR family putative transcriptional regulator
b0209	-1	23	-2.573040	endo/exonuclease/phosphatase family protein
b0210	-1	23	-3.023558	putative S-adenosyl-L-methionine-dependent
b0211	-1	23	-4.041154	putative membrane-bound lytic murein
b0212	-1	30	-7.559903	hydroxyacylglutathione hydrolase
b0213	0	29	-7.286559	putative S-adenosyl-L-methionine-dependent
b0214	0	30	-8.174556	ribonuclease HI, degrades RNA of DNA-RNA
b0215	0	30	-6.595204	DNA polymerase III epsilon subunit
b0217	1	32	-7.017319	*lipoprotein
b4586	-1	14	-0.531307	lethality reduction protein, putative inner
b0218	-1	14	1.452784	putative NAD(P)-binding C-N hydrolase family
b0219	-2	16	2.084888	inhibitor of c-type lysozyme, periplasmic
b0221	0	16	1.162304	acyl coenzyme A dehydrogenase
b0222	2	15	-1.784600	D-sedoheptulose 7-phosphate isomerase
b0223	3	19	-2.738560	type 2 glutamine amidotransferase family
b0224	1	21	0.042096	L,D-transpeptidase-related protein
b0225	2	22	0.798899	mRNA interferase toxin of toxin-antitoxin pair
b0226	2	21	1.851068	antitoxin of YafQ-DinJ toxin-antitoxin system
b0227	2	19	1.540839	putative lipoprotein and C40 family peptidase
b0228	2	18	0.870358	RAYT REP element-mobilizing transposase;
b0229	2	17	0.800166	DNA polymerase IV
b0230	3	19	-2.207156	antitoxin of the YafO-YafN toxin-antitoxin
b0231	2	20	-2.221814	mRNA interferase toxin of the YafO-YafN

b4626

b0304

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4626	6	32	3.180116	CP4-6 prophage; antitoxin of the YkfI-YafW
b0245	7	32	4.278642	uncharacterized protein
b0246	8	33	4.291724	CP4-6 prophage; RadC-like JAB domain protein
b0247	8	27	3.047968	CP4-6 prophage; uncharacterized protein
b0248	8	27	2.526563	CP4-6 prophage; uncharacterized protein
b0249	9	30	3.474451	CP4-6 prophage; uncharacterized protein
b0250	7	29	3.634281	lipoprotein, inner membrane; degP regulator;
b4627	3	24	1.815480	CP4-6 prophage; conserved protein
b4628	3	27	-0.409087	CP4-6 prophage; putative GTP-binding protein
b0252	3	26	0.019669	CP4-6 prophage; putative DNA-binding
b0253	3	27	-0.360716	IS30 transposase
b0254	1	21	-0.343721	IS5 transposase and trans-activator
b4587	-1	20	1.596247	CP4-6 prophage; putative S-methylmethionine
b0256	0	20	2.382285	CP4-6 prophage; S-methylmethionine:homocysteine
b0258	0	22	4.157559	CP4-6 prophage; putative ferric transporter
b0259	0	23	4.371689	IS1 transposase B
b0261	1	22	4.371915	IS1 repressor TnpA
b0263	0	24	0.252967	CP4-6 prophage; putative DNA-binding
b0264	2	27	4.024209	2-keto-3-deoxy gluconate (KDG) aldolase; CP4-6
b0265	2	29	5.838485	CP4-6 prophage; dehydratase family protein
b4708	2	42	9.827058	CP4-6 prophage; putative sugar transporter
b0266	3	55	11.564509	CP4-6 prophage; putative
b0267	3	58	12.009758	CP4-6 prophage; putative DNA-binding
b0269	2	58	11.249542	ornithine carbamoyltransferase 2, chain F; CP4-6
b0270	2	54	9.213446	IS1 transposase B
b0271	1	46	8.270872	IS1 repressor TnpA
b0272	1	28	3.705536	CP4-6 prophage; conserved protein
b0273	2	24	0.057499	CP4-6 prophage; DNA-binding protein
b0274	5	26	-7.504931	CP4-6 prophage; uncharacterized protein
b0275	7	31	-9.063345	CP4-6 prophage; uncharacterized protein
b0276	6	32	-9.213422	CP4-6 prophage; putative phage integrase
b0278	5	38	-9.829645	*moco insertion factor for PaoABC aldehyde
b0280	2	18	1.932740	PaoABC aldehyde oxidoreductase, Moco-containing
b4694	1	22	6.738568	PaoABC aldehyde oxidoreductase, FAD-containing
b4695	0	20	5.798114	PaoABC aldehyde oxidoreductase, 2Fe-2S subunit
b0283	0	20	5.289109	DUF1440 family inner membrane acid resistance
b0284	0	20	4.263063	UPF0153 cysteine cluster protein
b0285	0	18	1.279298	ECP production pilus chaperone
b0286	1	20	0.995358	polymerized tip adhesin of ECP fibers
b0287	1	21	0.996840	ECP production outer membrane protein
b0288	2	22	1.727622	ECP production pilus chaperone
b0290	3	22	0.237525	ECP pilin
b0291	3	22	0.106435	putative transcriptional regulator for the ecp
b0292	5	22	-3.919583	uncharacterized protein
b0294	8	35	-11.236462	RpmJ-like protein
b0295	2	34	-6.705327	50S ribosomal protein L31 type B; alternative
b4506	-1	29	-5.716051	uncharacterized protein
b0296	-1	22	-2.344809	IS3 transposase A
b4671	-2	23	-3.576226	IS3 transposase B
b4630	-2	23	-3.441360	reactive chlorine species (RCS) stress
b0298	0	25	-4.956578	reactive chlorine species (RCS) stress
b0300	2	32	-6.562761	reactive chlorine stress species (RCS)
b4631	2	29	-5.146060	reactive chlorine species (RCS)-specific
b0301	2	26	-3.898071	cysteine-rich LutA family protein; putative
b0303	1	24	-3.003062	ferridoxin-like LutB family protein; putative
b0304	1	23	-3.845914	LutC family protein; putative electron transport

b0316

b0349

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0316	2	17	0.865804	putative NAD(P)-binding succinyl-CoA synthase
b0317	1	18	1.961834	DUF1116 family protein
b0319	1	18	3.138868	carbamate kinase-like protein
b0321	-1	14	1.557728	putative metallo-dependent hydrolase domain
b0323	-1	13	-0.339313	broad specificity NADPH-dependent aldehyde
b0324	-1	14	-2.125148	uncharacterized protein
b0326	0	18	-1.776962	uncharacterized protein
b0328	0	17	2.603944	amino acid exporter for proline, lysine,
b0329	1	22	4.097264	periplasmic protein, function unknown, YhcN
b0330	0	21	4.358448	propionate catabolism operon regulatory protein
b0331	0	21	4.110372	2-methylisocitrate lyase
b0333	0	20	3.984182	2-methylcitrate synthase
b0334	0	19	4.141683	2-methylcitrate dehydratase
b0335	-1	18	3.526048	propionate--CoA ligase
b0336	0	14	3.199823	cytosine transporter
b0337	-1	16	2.012942	cytosine/isoguanine deaminase
b0338	0	14	0.254372	transcriptional activator of cyn operon;
b0339	-2	11	1.663873	carbonic anhydrase
b0340	-2	10	1.737892	cyanate aminohydrolase
b0341	-2	10	2.143464	putative cyanate transporter
b0342	-2	11	2.092600	thiogalactoside acetyltransferase
b0343	-2	13	3.271369	lactose permease
b0344	-2	14	4.526485	beta-D-galactosidase
b0345	-1	17	4.426341	lactose-inducible lac operon transcriptional
b0346	-1	15	4.134454	mhp operon transcriptional activator
b0347	0	15	4.250243	3-(3-hydroxyphenyl)propionate hydroxylase
b0348	0	13	4.269316	2,3-dihydroxyphenylpropionate 1,2-dioxygenase
b0349	1	12	3.180294	2-hydroxy-6-ketonona-2,4-dienedioic acid

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0323	CARBMTKINASE	46	2e-10	Bacterial carbamate kinase signature.
>CARBMTKINASE#Bacterial carbamate kinase signature. Length = 314 Score = 46.4 bits (110), Expect = 2e-10 Identities = 13/44 (29%), Positives = 24/44 (54%) Query: 1 MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASD 44 M + VV+A+GGN++ + S E + V+ A + E++A Sbjct: 1 MGKRVVIALGGNALQQRGQKGSYEEMMDNVRKTARQIAEIIARG 44

b0449

b0471

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0449	-1	13	3.010933	putative multidrug ABC transporter ATPase
b0450	-2	12	1.836529	nitrogen assimilation regulatory protein for
b0451	-2	12	0.289367	ammonium transporter
b0452	-1	13	-1.510474	acyl-CoA thioesterase 2
b0453	-1	17	-2.267863	outer membrane lipoprotein
b0454	2	19	-3.526024	excision repair protein, alkyltransferase-like
b0456	2	20	-4.995425	DUF1428 family protein
b0457	0	13	-1.590562	putative membrane-anchored cyclic-di-GMP
b0458	2	16	-0.292054	DUF1449 family inner membrane protein
b0459	2	15	-0.605619	maltose O-acetyltransferase
b0460	1	14	-0.184404	modulator of gene expression, with H-NS
b0461	2	15	0.023040	Hha toxicity attenuator; conjugation-related
b0462	2	15	0.903567	multidrug efflux system protein
b0463	2	12	0.252479	multidrug efflux system
b0464	2	13	0.100785	transcriptional repressor
b0465	3	15	2.313821	mechanosensitive channel protein, intermediate
b0466	4	15	4.158254	DUF2496 family protein
b0467	3	17	4.698033	primosomal replication protein N''
b0468	3	23	3.259313	DUF454 family inner membrane protein
b0469	4	27	3.088853	adenine phosphoribosyltransferase
b0470	2	22	2.982205	DNA polymerase III/DNA elongation factor III,
b0471	2	22	1.474654	DNA-binding protein, putative

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0462	ACRIFLAVINRP	67	1e-17	Acriflavin resistance protein family signature.
>ACRIFLAVINRP#Acriflavin resistance protein family signature. Length = 1034 Score = 66.8 bits (163), Expect = 1e-17 Identities = 36/44 (81%), Positives = 41/44 (93%) Query: 1 MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVT 44 M NFFI RPIFAWV+AII+M+AG LAIL+LPVAQYPTIAPPAV+ Sbjct: 1 MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVS 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0464	HTHTETR	52	1e-12	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 52.3 bits (125), Expect = 1e-12 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVT 44 MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVT Sbjct: 1 MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVT 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0471	60KDINNERMP	23	0.032	60kDa inner membrane protein signature.
>60KDINNERMP#60kDa inner membrane protein signature. Length = 548 Score = 23.4 bits (50), Expect = 0.032 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 11 MKQAQQMQEKMQKMQE 26 M + + +Q K+Q M+E Sbjct: 380 MAKMRMLQPKIQAMRE 395

b0482

b0498

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0482	1	12	3.398385	TraB family protein
b0483	0	14	3.711749	putative DNA-binding transcriptional regulator
b0484	0	14	3.895911	copper transporter
b0485	-1	14	1.045935	glutaminase 1
b0486	0	19	-0.168322	putative amino acid transporter
b0487	1	19	0.205973	copper-responsive regulon transcriptional
b0488	-1	17	0.022860	inner membrane protein; stimulator of the QmcA
b0489	-1	16	-0.387080	PHB domain membrane-anchored putative protease
b0490	-1	17	0.128246	iron export ABC transporter ATPase; peroxide
b0491	0	18	3.047673	iron export ABC transporter permease; peroxide
b0492	1	23	6.068338	DnaK co-chaperone, thioredoxin-like protein
b0493	1	22	5.159131	putative oxidoreductase
b0494	2	23	4.434393	acyl-CoA thioesterase 1 and protease I and
b0495	3	24	3.390245	putative ABC transporter ATPase
b0496	4	26	3.391325	putative ABC transporter permease
b0497	6	32	2.053113	Rhs protein with DUF4329 family putative toxin
b0498	2	31	-5.745632	putative immunity protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0493	DHBDHDRGNASE	28	0.001	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase sig...
>DHBDHDRGNASE#2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature. Length = 261 Score = 27.7 bits (61), Expect = 0.001 Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 16 KSVLITGCSSGIGLESALELKRQGFHVLA 44 K ITG + GIG A L QG H+ A Sbjct: 9 KIAFITGAAQGIGEAVARTLASQGAHIAA 37

b0508

b0562

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0508	2	16	-1.504261	putative uracil/xanthine transporter
b0509	2	15	-1.338756	glycerate kinase II
b0511	3	13	-1.219407	S-ureidoglycine aminohydrolase
b0512	3	13	-0.187312	allantoate amidohydrolase
b0513	4	17	0.729927	ureidoglycolate dehydrogenase
b0514	4	15	1.794592	putative NAD(P)-binding acyl-CoA synthetase
b0515	3	14	1.853376	NO-induced DUF1116 protein
b0516	2	16	3.124419	putative anaerobic allantoin catabolic oxamate
b0517	1	15	4.017649	putative carbonate kinase
b0518	2	15	4.864687	N5-carboxyaminoimidazole ribonucleotide
b4572	2	16	4.919616	N5-carboxyaminoimidazole ribonucleotide mutase
b0520	1	15	3.815314	UDP-2,3-diacylglucosamine pyrophosphohydrolase
b0521	1	18	3.298037	peptidyl-prolyl cis-trans isomerase B (rotamase
b0522	2	19	2.726771	cysteinyl-tRNA synthetase
b0523	3	20	2.222184	DUF457 family inner membrane protein
b0524	3	19	1.674976	ribosome-associated protein; putative
b0525	2	18	0.292308	bifunctional 5,10-methylene-tetrahydrofolate
b0526	0	14	-0.778466	FimA homolog, function unknown
b0527	1	21	-3.203601	putative periplasmic pilus chaperone
b0529	2	25	-4.171824	putative outer membrane export usher protein
b0531	1	28	-5.983934	FimA homolog, function unknown
b0533	2	30	-5.977562	FimA homolog, function unknown
b0535	2	29	-5.820870	response regulator family protein
b0537	4	31	-2.814271	*DLP12 prophage; putative phage integrase
b4633	1	25	0.929951	IS3 transposase A
b0539	2	26	-0.882269	IS3 transposase B
b4508	2	37	-7.671313	DLP12 prophage; multidrug resistance protein
b0542	4	41	-8.515920	DLP12 prophage; putative recombinase
b0540	3	46	-10.011502	inactive polymorphonuclear leukocyte migration
b0541	4	47	-10.422414	DLP12 prophage; putative DNA-binding
b0543	6	52	-12.486058	uncharacterized protein, DLP12 prophage
b0544	6	52	-12.215410	DLP12 prophage; uncharacterized protein
b0545	5	43	-7.919756	DLP12 prophage; conserved protein
b0546	2	32	-5.993280	DLP12 prophage; uncharacterized protein
b4588	3	29	-0.793938	DLP12 prophage; endonuclease RUS
b0547	3	26	-2.397517	uncharacterized protein, DLP12 prophage
b0548	3	30	-2.838125	DLP12 prophage; putative antitermination
b0549	6	28	-0.246646	IS5 transposase and trans-activator
b0550	6	30	-0.857116	DLP12 prophage; putative phage lysis protein
b4509	5	26	-1.930237	DLP12 prophage; putative lysozyme
b0551	5	25	-1.559177	DLP12 prophage; putative murein endopeptidase
b0553	7	28	0.087171	DLP12 prophage; putative lipoprotein
b0552	6	24	-0.944931	DLP12 prophage; putative lipoprotein
b0554	4	31	-6.640319	DLP12 prophage; uncharacterized protein
b0555	4	31	-7.464245	DLP12 prophage; uncharacterized protein
b0556	5	34	-8.464812	DUF3950 family protein, DLP12 prophage
b4510	3	32	-7.726160	DLP12 prophage; DNA packaging protein
b0557	2	31	-7.501299	global transcriptional activator; DLP12
b0558	4	27	-6.164795	DLP12 prophage; outer membrane protease VII;
b0559	5	27	-4.950190	*porin thermoregulatory transcriptional
b4589	4	28	-4.294366	PRK09936 family protein
b0560	4	32	-8.143703	bacteriophage N4 receptor, outer membrane
b4634	7	33	-9.703339	bacteriophage N4 receptor, inner membrane
b0561	4	29	-9.754015	copper-sensing histidine kinase in two-component
b0562	2	28	-8.291960	response regulator in two-component regulatory

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0521	CARBMTKINASE	50	1e-11	Bacterial carbamate kinase signature.
>CARBMTKINASE#Bacterial carbamate kinase signature. Length = 314 Score = 50.2 bits (120), Expect = 1e-11 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 2 KTLVVALGGNALLQRGEALTAENQYRNIASAVPALARL-ARSYR 44 K +V+ALGGNAL QRG+ + E N+ +A + AR Y Sbjct: 3 KRVVIALGGNALQQRGQKGSYEEMMDNVRKTARQIAEIIARGYE 46
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0557	PF06291	70	3e-20	Lambda prophage Bor protein
>PF06291#Lambda prophage Bor protein Length = 102 Score = 70.1 bits (171), Expect = 3e-20 Identities = 37/44 (84%), Positives = 39/44 (88%) Query: 1 MKKMLLATALALLITGCAQQTFTVQNKQTAVAPKETITHHFFVS 44 MKKML + ALA+LITGCAQQTFTV NK TAV PKETITHHFFVS Sbjct: 6 MKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVS 49
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0565	OMPTIN	66	3e-17	Omptin serine protease signature.
>OMPTIN#Omptin serine protease signature. Length = 317 Score = 65.8 bits (160), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGK 44 MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGK Sbjct: 1 MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGK 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0571	HTHFIS	29	4e-04	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 28.6 bits (64), Expect = 4e-04 Identities = 8/32 (25%), Positives = 16/32 (50%) Query: 2 KLLIVEDEKKTGEYLTKGLTEAGFVVDLADNG 33 +L+ +D+ L + L+ AG+ V + N Sbjct: 5 TILVADDDAAIRTVLNQALSRAGYDVRITSNA 36

b4511

b0613

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4511	0	13	3.541955	iron-enterobactin ABC transporter permease
b0586	1	13	3.898953	ferrienterobactin ABC transporter permease
b0587	1	14	3.289396	enterobactin exporter, iron-regulated
b0588	1	14	5.400465	ferrienterobactin ABC transporter periplasmic
b0589	0	15	5.513550	isochorismate synthase 1
b0590	-1	16	5.140737	2,3-dihydroxybenzoate-AMP ligase component of
b0591	-1	16	4.641041	isochorismatase
b0592	-2	16	4.324855	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
b0593	-1	19	4.796818	enterobactin synthesis proofreading
b0594	-1	21	4.677932	carbon starvation protein involved in peptide
b0596	0	17	4.184190	DUF466 family protein
b0598	0	14	1.395850	putative oxidoreductase
b0599	-1	18	-3.139234	methionine aminotransferase, PLP-dependent
b0601	-1	17	-4.090300	Spo0J family protein, ParB-like nuclease domain
b0602	-1	18	-3.814341	PAPS reductase-like domain protein
b0603	-1	15	-3.238814	putative DNA-binding transcriptional regulator
b0604	-1	18	-0.915639	thiol:disulfide interchange protein,
b0605	-1	19	-0.268847	alkyl hydroperoxide reductase, C22 subunit
b0606	1	15	-0.356315	alkyl hydroperoxide reductase, F52a subunit,
b0607	1	15	-0.304316	universal stress protein UP12
b0608	1	15	0.529138	putative Zn-dependent NAD(P)-binding
b0610	-1	16	2.105892	regulator of nucleoside diphosphate kinase
b0611	-1	17	2.583276	ribonuclease I
b0612	-1	18	3.126019	citrate/succinate antiporter; citrate carrier
b0613	-2	19	3.520507	2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0595	ISCHRISMTASE	79	4e-22	Isochorismatase signature.
>ISCHRISMTASE#Isochorismatase signature. Length = 312 Score = 78.9 bits (194), Expect = 4e-22 Identities = 27/44 (61%), Positives = 33/44 (75%) Query: 1 MAIPKLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVS 44 MAIP +Q Y +P + D+PQNKV W +P RA LLIHDMQ+YFV Sbjct: 1 MAIPAIQPYQMPTASDMPQNKVSWVPDPNRAVLLIHDMQNYFVD 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0596	DHBDHDRGNASE	55	3e-13	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase sig...
>DHBDHDRGNASE#2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature. Length = 261 Score = 54.7 bits (131), Expect = 3e-13 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 15/55 (27%) Query: 5 GKNVWVTGAGKGIGYATALAFVEAGAKVTGFD---------------QAFTQEQY 44 GK ++TGA +GIG A A GA + D +A E + Sbjct: 8 GKIAFITGAAQGIGEAVARTLASQGAHIAAVDYNPEKLEKVVSSLKAEARHAEAF 62
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0604	60KDINNERMP	24	0.024	60kDa inner membrane protein signature.
>60KDINNERMP#60kDa inner membrane protein signature. Length = 548 Score = 23.7 bits (51), Expect = 0.024 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 18 EELPAPVKAIEKQGITIIKTF 38 EL P+ + G T KTF Sbjct: 145 NELQVPMTYTDAAGNTFTKTF 165
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0606	STREPTOPAIN	27	0.002	Streptopain (C10) cysteine protease family signature.
>STREPTOPAIN#Streptopain (C10) cysteine protease family signature. Length = 398 Score = 27.0 bits (59), Expect = 0.002 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 2 LDTNMKTQLKAYLEKLTKPVELIATLDDS-AKSAEIKE 38 D N K + +++E + ++ LD + A +AEIK+ Sbjct: 109 FDANGKENIASFMESYVEQIKENKKLDTTYAGTAEIKQ 146

b0683

b0740

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0683	2	22	-2.143432	ferric iron uptake regulon transcriptional
b4637	0	21	0.433626	ryhB-regulated fur leader peptide
b0684	-1	19	-0.111597	flavodoxin 1
b0685	-2	18	-0.910292	LexA-regulated protein, CopB family
b0686	-2	18	-1.231754	acyl-CoA esterase
b0687	-1	15	-1.271248	negative modulator of initiation of replication
b0688	-1	15	-1.611465	phosphoglucomutase
b0689	1	19	-3.548912	lipoprotein
b0691	-1	15	-2.205299	putrescine/proton symporter:
b4636	-2	13	1.215178	ornithine decarboxylase isozyme, inducible
b0692	-2	11	1.365061	uncharacterized protein
b0693	-2	11	2.503504	response regulator in two-component regulatory
b4590	-2	15	4.136994	fused sensory histidine kinase in two-component
b0694	-1	16	4.447327	potassium translocating ATPase, subunit C
b0695	-1	16	4.243030	potassium translocating ATPase, subunit B
b0696	1	20	5.251903	potassium translocating ATPase, subunit A
b0697	1	19	4.496200	potassium ion accessory transporter subunit
b0698	4	23	4.314935	DUF2517 family protein
b4513	4	25	2.867439	Rhs protein with putative toxin domain; putative
b0699	4	23	2.370671	putative membrane protein
b0700	3	23	0.628342	putative secreted protein
b0702	6	29	-7.670008	H repeat-associated putative transposase
b0703	4	25	-6.105410	DUF1722 family protein
b0704	1	26	-6.845963	deoxyribodipyrimidine photolyase, FAD-binding
b4514	0	15	-4.005969	dipeptide and tripeptide permease D
b0705	0	15	-2.917477	NIF3 family metal-binding protein
b0706	-2	13	-0.300929	putative allophanate hydrolase, subunit 1
b0707	-1	13	1.924687	putative allophanate hydrolase, subunit 2
b0708	-1	13	2.695556	UPF0271 family protein
b0709	-1	14	2.657410	endonuclease VIII and
b0710	0	17	3.637041	regulator of aidB expression; inner membrane
b0711	-1	14	1.772726	putative fimbrial protein
b0712	0	15	0.440074	putative periplasmic pilin chaperone
b0713	-2	15	-0.838376	putative outer membrane protein
b0714	-1	16	-1.941625	putative fimbrial-like adhesin protein
b0715	-1	14	-2.074997	citrate synthase
b0716	0	15	-3.140103	succinate dehydrogenase, membrane subunit, binds
b0717	0	17	-2.294726	succinate dehydrogenase, membrane subunit, binds
b0718	1	17	-0.344689	succinate dehydrogenase, flavoprotein subunit
b0719	1	21	0.413240	succinate dehydrogenase, FeS subunit
b0720	1	26	2.151814	2-oxoglutarate decarboxylase, thiamine
b0721	3	26	3.058154	dihydrolipoyltranssuccinase
b0722	2	28	3.250344	succinyl-CoA synthetase, beta subunit
b0723	2	29	3.278544	succinyl-CoA synthetase, NAD(P)-binding, alpha
b0724	2	26	2.324527	transcriptional repressor for the
b0726	1	20	2.626902	fused 2-O-a-mannosyl-D-glycerate specific PTS
b0727	-2	11	0.665216	alpha-mannosidase
b0728	-2	11	0.270287	cytochrome d terminal oxidase, subunit I
b0729	-2	10	0.203764	cytochrome d terminal oxidase, subunit II
b0730	-2	9	0.013493	cytochrome d (bd-I) ubiquinol oxidase subunit X
b0732	0	14	-0.674216	putative inner membrane protein in cydABX-ybgE
b0734	1	18	-0.071449	acyl-CoA thioester hydrolase
b4515	7	19	-0.609818	membrane spanning protein in TolA-TolQ-TolR
b0735	4	20	-0.062985	membrane spanning protein in TolA-TolQ-TolR
b0736	4	23	0.022512	membrane anchored protein in TolA-TolQ-TolR
b0737	4	22	-0.172135	periplasmic protein
b0738	4	21	-0.309950	peptidoglycan-associated outer membrane
b0739	3	19	-0.752801	periplasmic TolA-binding protein
b0740	2	16	-0.686269	*******quinolinate synthase, subunit A

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0694	HTHFIS	32	4e-05	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 31.7 bits (72), Expect = 4e-05 Identities = 10/37 (27%), Positives = 14/37 (37%) Query: 2 TNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGL 38 +L+ +D+ AIR L AL G V Sbjct: 4 ATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLW 40
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0718	PF00577	28	7e-04	Outer membrane usher protein FimD
>PF00577#Outer membrane usher protein FimD Length = 878 Score = 28.3 bits (63), Expect = 7e-04 Identities = 8/52 (15%), Positives = 16/52 (30%), Gaps = 11/52 (21%) Query: 4 YRLSFVSCLVMAMPCAMA-----------VEFNLNVLDKSMRDRIDISLLKE 44 R ++ + + A A + FN L + D+S + Sbjct: 18 IRKHRLAGFFVRLFVACAFAAQAPLSSAELYFNPRFLADDPQAVADLSRFEN 69

b0790

b0795

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0790	-1	20	3.213104	endo/exonuclease/phosphatase family protein
b0791	-2	21	3.057183	inner membrane protein
b0792	-1	19	3.431357	putative ABC transporter permease
b0793	-1	17	3.570903	putative ABC transporter permease
b0794	-1	15	3.225722	putative ABC transporter ATPase
b0795	-1	13	3.184084	putative membrane fusion protein (MFP) component

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0795	FLGMRINGFLIF	25	0.008	Flagellar M-ring protein signature.
>FLGMRINGFLIF#Flagellar M-ring protein signature. Length = 559 Score = 25.3 bits (55), Expect = 0.008 Identities = 9/40 (22%), Positives = 16/40 (40%) Query: 2 MKKPVVIGLAVVVLAAVVAGGYWWYQSRQDNGLTLYGNVD 41 ++ I L V AAV ++ + TL+ N+ Sbjct: 19 LRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLS 58

b0823

b0833

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b0823	-2	13	3.438289	putative pyruvate formate lyase
b0824	-1	11	3.174198	putative pyruvate formate lyase activating
b0825	-1	12	2.682239	fructose-6-phosphate aldolase 1
b0826	-1	12	2.590570	molybdopterin synthase sulfurylase
b0827	0	14	2.346362	molybdopterin molybdenumtransferase;
b0828	0	15	-1.429039	Isoaspartyl peptidase
b0829	0	15	-3.121547	glutathione ABC transporter ATPase
b0830	0	12	-3.682393	glutathione ABC transporter periplasmic binding
b0831	0	11	-4.523491	glutathione ABC transporter permease
b0832	1	10	-4.635069	glutathione ABC transporter permease
b0833	1	10	-4.963986	putative membrane-anchored cyclic-di-GMP

b0896

b0902

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b0896	1	17	-3.163139	dimethyl sulfoxide reductase, anaerobic, subunit
b0897	1	16	-3.881252	putative isochorismatase family hydrolase
b0898	2	19	-2.688402	putative MFS transporter, inner membrane
b0899	3	23	-3.201506	putative transporter
b0900	2	26	-2.186800	LysR family putative transcriptional regulator
b0901	3	26	-1.995388	putative NAD(P)H-dependent oxidoreductase
b0902	2	27	-1.392629	pyruvate formate-lyase 1-activating enzyme;

b0936

b0941

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0936	2	20	-3.440706	aliphatic sulfonate ABC transporter periplasmic
b0937	1	23	-4.189240	NAD(P)H-dependent FMN reductase
b0938	2	25	-4.848997	laminin-binding fimbrin subunit
b0939	1	23	-3.894588	putative periplasmic pilin chaperone
b0940	0	21	-3.726652	putative outer membrane fimbrial subunit export
b0941	-1	23	-3.425149	putative fimbrial-like adhesin protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b0938	FIMBRIALPAPE	23	0.029	Escherichia coli: P pili tip fibrillum papE protein...
>FIMBRIALPAPE#Escherichia coli: P pili tip fibrillum papE protein signature. Length = 173 Score = 23.5 bits (50), Expect = 0.029 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Query: 6 LTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACT 44 L + V + V AAD+ +TF GK+I PACT Sbjct: 9 LPVMLGAVLMSQHVHAADN-------LTFKGKLIIPACT 40

b0998

b1043

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b0998	-2	16	-4.632564	TorA-maturation chaperone
b0999	-1	16	-4.557496	modulator of CbpA co-chaperone
b1000	-1	17	-4.887482	DnaK co-chaperone; curved DNA-binding protein
b1001	0	17	-4.070863	uncharacterized protein
b1002	1	15	1.514127	glucose-1-phosphatase/inositol phosphatase
b1003	2	18	2.813486	uncharacterized protein
b1004	1	17	3.912401	NAD(P)H:quinone oxidoreductase
b4518	0	18	4.020636	KGG family protein
b1006	-1	18	4.138502	pyrimidine permease
b1007	-2	20	4.521596	flavin:NADH reductase
b1008	0	16	3.461357	putative malonic semialdehyde reductase
b1009	-1	12	4.183447	putative reactive intermediate detoxifying
b1010	0	14	3.575857	putative aminoacrylate deaminase, reactive
b1011	-1	13	3.524518	ureidoacrylate amidohydrolase
b1012	-1	14	3.027098	pyrimidine oxygenase, FMN-dependent
b1013	0	14	2.850551	rut operon transcriptional repressor for
b1014	-1	12	2.799379	fused DNA-binding transcriptional
b1015	0	15	0.616791	proline:sodium symporter
b4490	-2	14	-0.957312	inactive ferrous ion transporter EfeUOB
b1018	-2	18	-3.145025	deferrrochelatase, periplasmic
b1019	-2	23	-3.886061	ATP-binding protein; putative PhoH family P-loop
b1020	-1	28	-6.229772	biofilm PGA synthase PgaCD, regulatory subunit;
b1021	0	27	-6.083312	biofilm PGA synthase PgaCD, catalytic subunit;
b1022	-1	26	-5.852246	poly-beta-1,6-N-acetyl-D-glucosamine (PGA)
b1023	-1	29	-6.090832	biofilm adhesin polysaccharide PGA secretin; OM
b1024	0	28	-6.486266	diguanylate cyclase, membrane-anchored
b1025	-1	26	-6.328580	IS3 transposase B
b1026	-1	22	-3.557203	IS3 transposase A
b1027	0	22	-4.343159	putative inner membrane protein
b1028	1	21	-3.755971	*glyoxylate/hydroxypyruvate reductase A
b1029	0	18	-3.042927	alkaline phosphatase
b1033	0	18	-1.655128	redox enzyme maturation protein (REMP) chaperone
b1034	-1	17	-2.748652	DUF1097 family inner membrane protein
b1035	0	19	-4.015116	curli production assembly/transport outer
b1036	1	23	-5.825288	curli nucleation outer membrane protein
b1037	0	25	-6.306978	curlin secretion specificity factor
b1038	2	33	-8.077621	csgBAC operon transcriptional regulator
b1039	1	32	-7.886917	curlin nucleator protein, minor subunit in curli
b1040	2	30	-6.256644	curlin subunit, amyloid curli fibers, cryptic
b1041	0	25	-3.480585	curli assembly protein
b1042	0	20	-4.014626	uncharacterized protein
b1043	-1	16	-3.704053	O-acetyl-ADP-ribose deacetylase; RNase III

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1011	ISCHRISMTASE	25	0.010	Isochorismatase signature.
>ISCHRISMTASE#Isochorismatase signature. Length = 312 Score = 25.0 bits (54), Expect = 0.010 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 12 TFDPQQSALIVVDMQNAYATP 32 DP ++ L++ DMQN + Sbjct: 25 VPDPNRAVLLIHDMQNYFVDA 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1013	HTHTETR	29	3e-04	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 29.2 bits (65), Expect = 3e-04 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 10 GKRSRAVSAKKKAILSAALDTFSQFGFHGTRLEQI 44 K + ++ IL AL FSQ G T L +I Sbjct: 3 RKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEI 37

b1067

b1084

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1067	2	16	1.136769	putative lipid II flippase
b1069	0	12	0.797652	export chaperone for FlgK and FlgL
b1070	1	20	0.700326	anti-sigma factor for FliA (sigma 28)
b1071	2	16	0.859263	assembly protein for flagellar basal-body
b1072	1	16	2.030197	flagellar component of cell-proximal portion of
b1073	2	15	2.258396	flagellar component of cell-proximal portion of
b1074	3	14	2.223915	flagellar hook assembly protein
b1075	2	12	2.344325	flagellar hook protein
b1076	0	12	2.375256	flagellar component of cell-proximal portion of
b1077	-1	12	2.259536	flagellar component of cell-distal portion of
b1078	0	9	1.113709	flagellar protein of basal-body outer-membrane L
b1079	0	13	2.045669	putative flagellar basal body protein
b1081	1	15	1.372129	flagellar rod assembly protein and murein
b1082	2	15	0.953579	flagellar hook-filament junction protein 1
b1083	3	17	0.944183	flagellar hook-filament junction protein
b1084	4	19	1.322512	endoribonuclease; RNA-binding protein;RNA

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1076	FLGHOOKAP1	29	4e-04	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 28.8 bits (64), Expect = 4e-04 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 6 AVSGLNAAATNLDVIGNNIANSATYGFK 33 A+SGLNAA L+ NNI++ G+ Sbjct: 7 AMSGLNAAQAALNTASNNISSYNVAGYT 34
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1078	FLGHOOKAP1	40	4e-08	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 39.9 bits (93), Expect = 4e-08 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 3 SSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAV 40 S + A +GL+A Q ++ +NN+++ + G+ RQ + Sbjct: 2 SLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTI 39
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1079	FLGLRINGFLGH	77	8e-22	Flagellar L-ring protein signature.
>FLGLRINGFLGH#Flagellar L-ring protein signature. Length = 232 Score = 76.9 bits (189), Expect = 8e-22 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT 44 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT Sbjct: 1 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1080	FLGPRINGFLGI	51	5e-12	Flagellar P-ring protein signature.
>FLGPRINGFLGI#Flagellar P-ring protein signature. Length = 373 Score = 51.1 bits (122), Expect = 5e-12 Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 4 FLSALILLLVTTAAQAERIRDLTSVQGVRQNSLIGYGLVVG 44 F + L A RI+D+ S+Q R N LIGYGLVVG Sbjct: 13 FSALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVG 53
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1081	FLGFLGJ	76	7e-21	Flagellar protein FlgJ signature.
>FLGFLGJ#Flagellar protein FlgJ signature. Length = 313 Score = 75.5 bits (185), Expect = 7e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF 44 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF Sbjct: 1 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1082	FLGHOOKAP1	54	5e-13	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 53.8 bits (129), Expect = 5e-13 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 2 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA 44 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA Sbjct: 1 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1083	FLAGELLIN	25	0.014	Flagellin signature.
>FLAGELLIN#Flagellin signature. Length = 507 Score = 24.6 bits (53), Expect = 0.014 Identities = 9/36 (25%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query: 7 MMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDD 42 ++ Q N+ +S + + E++S+G R+ + DD Sbjct: 11 LLTQNNLNKSQSSLSSAI---ERLSSGLRINSAKDD 43

b1133

b1180

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b1133	0	21	-5.610577	tRNA(Gln,Lys,Glu) U34 2-thiouridylase
b1134	1	29	-9.227227	bifunctional thiamine pyrimidine pyrophosphate
b1135	3	33	-9.431576	23S rRNA pseudouridine(2457) synthase
b1136	4	36	-10.514564	isocitrate dehydrogenase; e14 prophage
b1137	5	47	-13.536849	e14 prophage; putative SAM-dependent
b1138	5	45	-12.163895	e14 prophage; putative inner membrane protein
b1139	5	42	-9.551097	T4 phage exclusion protein; cell death
b1140	4	39	-7.824503	e14 prophage; putative integrase
b1141	3	33	-6.841662	e14 prophage; putative excisionase
b1143	4	33	-6.092982	e14 prophage; uncharacterized protein
b1144	3	33	-4.175413	e14 prophage; uncharacterized protein
b1145	2	21	-1.700541	e14 prophage; repressor protein phage e14
b1146	1	22	0.440074	e14 prophage; putative DNA-binding
b1147	2	23	1.582766	e14 prophage; putative DNA-binding
b1148	4	22	3.380074	e14 prophage; uncharacterized protein
b4692	5	21	4.286001	e14 prophage; uncharacterized protein
b4693	4	19	3.419351	prohage e14 tail protein homolog
b1150	4	18	1.951133	e14 prophage; uncharacterized protein
b1151	4	19	0.551053	e14 prophage; uncharacterized protein
b1152	5	23	-0.634015	e14 prophage; putative tail fiber assembly
b1153	3	28	-2.604148	e14 prophage; site-specific DNA recombinase
b1154	3	38	-6.494641	putative
b1155	4	40	-7.442765	RpoS stabilzer during Mg starvation, anti-RssB
b1156	5	41	-8.248904	DUF1398 family protein
b1157	5	43	-10.141221	repressor of blue light-responsive genes
b1158	4	39	-9.256742	anti-repressor for YcgE, blue light-responsive;
b1159	3	37	-9.877576	RcsB connector protein for regulation of biofilm
b4519	2	33	-8.916978	RcsB connector protein for regulation of
b1160	2	35	-9.619490	RcsB connector protein for regulation of biofilm
b1161	2	37	-9.393391	Blue light, low temperature and stress induced
b1162	3	36	-9.183874	putative membrane-anchored cyclic-di-GMP
b1163	2	35	-9.579054	inner membrane division septum protein
b1164	3	37	-10.312568	uncharacterized protein
b1165	3	35	-9.430680	UPF0757 family protein
b1166	2	33	-8.975753	uncharacterized protein
b1167	1	31	-7.967984	uncharacterized protein
b1168	1	31	-7.969761	cell division topological specificity factor
b4520	1	34	-8.532684	inhibitor of FtsZ ring polymerization;
b4491	1	32	-7.766330	inhibitor of FtsZ ring polymerization
b1171	0	31	-6.582568	uncharacterized protein
b1172	-1	25	-4.779458	periplasmic inhibitor of g-type lysozyme
b4593	-1	24	-4.384130	UPF0745 family protein
b4594	-1	23	-4.105489	putative isomerase/hydrolase
b4521	-1	21	-4.144049	UPF0153 family cysteine cluster protein
b1174	0	21	-4.853311	hemolysin E
b1175	-1	20	-3.544487	translesion error-prone DNA polymerase V
b1176	-2	21	-4.115746	translesion error-prone DNA polymerase V
b1177	-2	20	-6.797018	oxidoreductase that catalyzes reoxidation of
b1178	-1	18	-6.066029	sodium:proton antiporter
b1179	-2	18	-4.146520	fatty acid metabolism regulon transcriptional
b1180	-2	15	-3.254244	SpoVR family stationary phase protein

b1247

b1255

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1247	-1	19	-3.336840	UPF0263 family protein
b1248	-1	21	-3.047773	cardiolipin synthase 1
b1249	-1	23	-2.970404	uncharacterized protein
b4595	-1	23	-4.562483	voltage-gated potassium channel
b1250	-1	21	-4.322310	putative DGPF domain-containing enzyme
b1251	2	17	-1.888731	membrane spanning protein in TonB-ExbB-ExbD
b1252	0	18	-3.125858	acyl-CoA esterase
b1253	0	22	-5.207170	IspA family inner membrane protein
b1254	0	21	-5.170712	UPF0259 family inner membrane protein
b1255	-1	20	-3.501593	outer membrane protein W

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1252	TONBPROTEIN	79	2e-22	Gram-negative bacterial tonB protein signature.
>TONBPROTEIN#Gram-negative bacterial tonB protein signature. Length = 239 Score = 78.9 bits (194), Expect = 2e-22 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQP 44 MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQP Sbjct: 1 MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQP 44

b1297

b1306

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1297	-1	17	3.815039	glutamate--putrescine ligase
b1298	0	17	3.695966	gamma-glutamyl-gamma-aminobutyrate hydrolase
b1299	1	18	3.428629	repressor for the divergent puu operons,
b1300	2	20	3.548101	gamma-glutamyl-gamma-aminobutyraldehyde
b1301	2	17	2.560880	gamma-glutamylputrescine oxidoreductase
b1302	2	12	1.247591	4-aminobutyrate aminotransferase, PLP-dependent
b1303	3	12	-1.103468	psp operon transcriptional activator
b1304	-1	18	-4.710416	regulatory protein for phage-shock-protein
b1305	-1	15	-4.151499	psp operon transcription co-activator
b1306	-1	13	-3.043302	psp operon transcription co-activator

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1303	HTHFIS	47	1e-10	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 47.1 bits (112), Expect = 1e-10 Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 6 DNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKEL 44 L+G + + E+ ++ L D ++I GE GTGKEL Sbjct: 137 MPLVGRSAAMQEIYRVLARLMQTDLTLMITGESGTGKEL 175

b1341

b1373

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1341	-2	19	-3.407614	tRNA s(2)C32 thioltransferase, iron sulfur
b1342	-2	20	-3.801031	Rac prophage; integrase
b1343	-1	22	-5.071549	Rac prophage; conserved protein
b1344	1	23	-6.964540	DUF1187 family protein, Rac prophage; putative
b1345	2	26	-5.393541	Rac prophage; restriction alleviation protein
b1346	2	28	-4.861449	Rac prophage; recombination and repair protein
b1347	2	29	-5.163066	Rac prophage; exonuclease VIII, 5' to 3'
b1348	2	29	-4.826263	Rac prophage; uncharacterized protein
b1349	2	27	-5.597364	conserved protein, Rac prophage
b1350	2	28	-5.662453	killing protein, Rac prophage; FtsZ inhibitor
b1351	1	30	-11.333110	phage superinfection exclusion protein, Rac
b4526	3	33	-10.692292	uncharacterized protein, Rac prophage
b1352	3	37	-9.895609	Rac prophage; uncharacterized protein
b1353	2	30	-7.989482	Rac prophage; putative DNA-binding
b4527	4	30	-5.125989	Rac prophage; putative DNA-binding
b1355	3	27	-3.733490	Rac prophage; uncharacterized protein
b1356	3	28	-3.751742	Rac prophage; conserved protein
b1357	2	26	-2.256777	Rac prophage; putative DNA replication protein
b1358	2	26	-1.242160	Rac prophage; putative lipoprotein
b1359	1	33	-5.623917	Rac prophage; potassium transporter subunit
b1360	0	32	-5.886597	Rac prophage; conserved protein
b1361	2	38	-7.002657	IS5 transposase and trans-activator
b1362	3	40	-7.087253	Rac prophage; putative tail fiber protein
b4528	3	40	-7.408875	Rac prophage; putative tail fiber assembly
b1363	4	31	-5.437666	Rac prophage; putative site-specific
b1365	2	22	0.283853	cold shock protein, Rac prophage
b1366	2	22	0.089895	stress-induced protein, ATP-binding protein
b1368	1	21	-0.355980	outer membrane pore protein N, non-specific
b4570	0	20	-0.122564	pyruvate-flavodoxin oxidoreductase
b1370	0	22	-0.446291	DUF333 family putative lipoprotein
b1372	0	27	-1.443807	heat-inducible lipoprotein involved in
b1373	1	26	-6.130467	fermentative D-lactate dehydrogenase,

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1377	ECOLIPORIN	87	7e-25	E.coli/Salmonella-type porin signature.
>ECOLIPORIN#E.coli/Salmonella-type porin signature. Length = 383 Score = 86.9 bits (215), Expect = 7e-25 Identities = 41/44 (93%), Positives = 43/44 (97%) Query: 1 MKSKVLALLIPALLAAGAAHAAEVYNKDGNKLDLYGKVDGLHYF 44 MK KVLAL+IPALLAAGAAHAAE+YNKDGNKLDLYGKVDGLHYF Sbjct: 1 MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYF 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1379	PF06291	32	2e-05	Lambda prophage Bor protein
>PF06291#Lambda prophage Bor protein Length = 102 Score = 31.9 bits (72), Expect = 2e-05 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Query: 1 MKKVAAFVALSLLMAGC------VSNDKIAVTPEQLQHHRFVLESVNGK 43 MKK+ AL++L+ GC V N AVTP++ H F + + K Sbjct: 6 MKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVSGIGQK 54

b1397

b1407

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b1397	2	14	-0.541292	IS2 repressor TnpA
b1398	2	15	-0.889699	IS30 transposase
b1399	1	18	-0.963036	putative NAD(P)-binding oxidoreductase
b1400	2	22	-1.915312	PF10971 family putative periplasmic
b4674	1	20	-1.519796	inner membrane protein
b4492	0	22	-3.170149	putative CDP-diglyceride synthase
b1402	0	29	-4.038063	putative esterase
b1403	-1	30	-5.713576	putative phosphatase inner membrane protein
b1404	-2	30	-4.937066	NADH-azoreductase, FMN-dependent
b1406	-2	28	-4.161859	putative ATP-dependent helicase
b1407	-2	26	-4.435209	DUF218 superfamily protein, SAM-binding

b1451

b1460

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b1451	2	13	0.419567	glutathione S-transferase homolog
b1452	1	18	-1.192699	IPR020099 family protein
b1453	1	24	-3.478015	putative immunity protein for RhsE
b1454	3	30	-5.813493	H repeat-associated putative transposase
b1455	3	29	-6.109026	4-oxalocrotonate tautomerase
b1456	2	27	-4.989773	flavin reductase like-protein
b1457	2	34	-9.429376	N-hydroxyarylamine O-acetyltransferase
b1459	1	27	-6.078231	PhzC-PhzF family protein
b1460	0	20	-3.081771	nitrate reductase 2 (NRZ), gamma subunit

b1490

b1505

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1490	-1	13	-3.865271	putative TonB-dependent outer membrane receptor
b1491	-1	13	-4.075628	putative multidrug ABC transporter
b1492	-1	14	-5.588099	putative YdeN-specific sulfatase-maturating
b1493	-2	16	-6.173806	putative Ser-type periplasmic non-aryl
b1494	-1	22	-7.647976	UV-inducible global regulator, EvgA-,
b1495	0	22	-8.688591	two-component system connector membrane protein,
b1496	0	25	-7.450862	putative oxidoreductase
b1497	1	27	-7.232601	putative fimbrial-like adhesin protein
b1498	1	27	-6.132675	putative fimbrial-like adhesin protein
b1499	1	27	-5.697372	putative fimbrial-like adhesin protein
b1500	3	28	-5.141773	inactivating GltX kinase facilitating persister
b1502	3	30	-6.128306	antitoxin of HipAB toxin-antitoxin system
b1503	1	28	-5.974510	autoinducer-2 (AI-2) kinase
b1504	3	29	-3.117190	lsr operon transcriptional repressor
b1505	2	27	-2.347028	autoinducer 2 import ATP-binding protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1499	SECA	28	0.001	SecA protein signature.
>SECA#SecA protein signature. Length = 901 Score = 27.5 bits (61), Expect = 0.001 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Query: 7 VIFIHHAFNANIL---DKDYAFSDGEILMVD 34 + + A A+ L D DY DGE+++VD Sbjct: 307 MHHVTAALRAHALFTRDVDYIVKDGEVIIVD 337
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1503	FIMBRIALPAPF	27	0.002	Escherichia coli: P pili tip fibrillum papF protein...
>FIMBRIALPAPF#Escherichia coli: P pili tip fibrillum papF protein signature. Length = 167 Score = 27.0 bits (59), Expect = 0.002 Identities = 12/26 (46%), Positives = 14/26 (53%) Query: 16 LFTATLQAADVTITVNGRVVAKPCTI 41 L T+ ADV I + G V PCTI Sbjct: 11 LLTSVAVLADVQINIRGNVYIPPCTI 36

b1526

b1579

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1526	0	16	-3.534008	cysteine and O-acetyl-L-serine efflux system
b1527	1	19	-4.573800	putative transporter
b1528	2	18	-1.777931	inner membrane-associated protein
b1530	1	17	-2.868016	diguanylate cyclase, zinc-sensing
b1531	0	19	-3.910147	hydrogen peroxide resistance OB fold protein;
b1533	0	19	-3.687298	inactive PncC family protein
b1534	1	20	-3.256236	dipeptidyl carboxypeptidase II
b4599	1	23	-3.250457	NADP-dependent 3-hydroxy acid dehydrogenase;
b1535	0	20	-2.875418	transcriptional repressor for rspAB
b1536	0	19	-1.952597	selenoprotein, function unknown
b1537	-1	17	-1.896773	putative NAD-dependent D-mannonate
b1538	-1	19	-2.442656	cold shock protein, function unknown, Qin
b1539	-1	20	-3.392432	Qin prophage; putative site-specific
b1540	-1	23	-4.231164	Qin prophage; putative tail fibre assembly
b1541	0	26	-4.533462	Qin prophage; putative side tail fibre assembly
b1542	1	26	-3.713057	uncharacterized protein, Qin prophage
b1544	1	28	-3.283346	Qin prophage; uncharacterized protein
b1546	0	29	-4.996960	Qin prophage; multicopy suppressor of secG(Cs)
b1547	0	29	-5.533994	Qin prophage; cold shock-induced protein
b1548	7	34	-9.827490	Qin prophage; cold shock protein
b4533	6	42	-12.223404	Rz-like protein, Qin prophage
b1549	6	37	-11.422014	putative Rz1-like lipoprotein, Qin prophage
b1550	3	26	-6.488616	Qin prophage; putative lysozyme
b1551	5	25	-5.400718	Qin prophage; uncharacterized protein
b1552	4	26	-5.196864	Qin prophage; putative S lysis protein
b1553	4	28	-5.758135	Qin prophage; cold shock protein
b4689	2	28	-5.394781	Qin prophage; cold shock protein
b1554	3	30	-5.230616	Qin prophage; putative antitermination protein
b1555	2	28	-3.872793	Qin prophage; uncharacterized protein
b1556	1	29	-4.066029	Qin prophage; uncharacterized protein
b1557	1	28	-3.699868	Qin prophage; small toxic polypeptide
b1558	1	29	-2.802509	Qin prophage; toxin of the RelE-RelB
b1559	1	28	-2.920842	antitoxin of the RelE-RelB toxin-antitoxin
b1560	3	29	-2.978187	Qin prophage; uncharacterized protein
b1561	7	36	-6.446982	Qin prophage; uncharacterized protein
b1562	8	33	-5.827871	Qin prophage; DNA-binding transcriptional
b1563	6	32	-5.619129	Qin prophage; putative regulator for DicB
b1564	5	32	-5.660601	Qin prophage; uncharacterized protein
b1565	6	35	-6.384037	Qin prophage; uncharacterized protein
b1566	7	32	-6.246323	uncharacterized protein, Qin prophage
b1567	7	33	-5.523461	Qin prophage; cell division inhibition protein
b1568	6	31	-4.938040	Qin prophage; uncharacterized protein
b1569	5	32	-7.249212	putative Zn-dependent NAD(P)-binding
b1570	4	36	-7.837620	bifunctional D-altronate/D-mannonate
b1571	1	27	-5.601383	UPF0060 family inner membrane protein
b1572	1	26	-3.101237	UPF0482 family putative periplasmic protein
b1573	1	29	-5.357489	spermidine N(1)-acetyltransferase
b1575	0	27	-5.839326	UPF0257 family lipoprotein
b1576	0	22	-4.332405	DUF1161 family periplasmic protein
b1577	-1	20	-3.910242	putative selenate reductase, periplasmic
b1579	-1	19	-4.904590	S- and N-oxide reductase, A subunit,

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1539	NUCEPIMERASE	38	2e-07	Nucleotide sugar epimerase signature.
>NUCEPIMERASE#Nucleotide sugar epimerase signature. Length = 334 Score = 37.8 bits (88), Expect = 2e-07 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 11/53 (20%) Query: 1 MIVLVTGATAGF-GECITRRFIQQGHKVIA---------TGRRQERLQELKDE 43 M LVTGA AGF G +++R ++ GH+V+ +Q RL+ L Sbjct: 1 MKYLVTGA-AGFIGFHVSKRLLEAGHQVVGIDNLNDYYDVSLKQARLELLAQP 52
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4689	cdtoxina	23	0.047	Cytolethal distending toxin A signature.
>cdtoxina#Cytolethal distending toxin A signature. Length = 258 Score = 23.1 bits (49), Expect = 0.047 Identities = 11/42 (26%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MRNRNLLKFLPGLLICLIVLTSCVPKQKNMPYALTQRSIPQI 42 M N+ F+ G+LI +++ + KN Y + PQ+ Sbjct: 1 MANKRTPIFIAGILIPILL--NGCSSGKNKAYLDPKVFPPQV 40
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1562	HOKGEFTOXIC	49	1e-12	Hok/Gef cell toxic protein family signature.
>HOKGEFTOXIC#Hok/Gef cell toxic protein family signature. Length = 52 Score = 49.4 bits (118), Expect = 1e-12 Identities = 16/41 (39%), Positives = 29/41 (70%) Query: 4 QKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVF 44 + +++ ++++CLT+++ +TRK LCE+R R G EVA F Sbjct: 5 RSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAF 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1585	PF06291	26	0.005	Lambda prophage Bor protein
>PF06291#Lambda prophage Bor protein Length = 102 Score = 25.8 bits (56), Expect = 0.005 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 1 MKYKLLPCLLAIFLTGCDRTEVTLSFTP 28 MK L LA+ +TGC + T+ P Sbjct: 6 MKKMLFSAALAMLITGCAQQTFTVGNKP 33

b1712

b1755

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1712	3	30	1.175856	integration host factor (IHF), DNA-binding
b1713	4	30	0.847223	phenylalanine tRNA synthetase, beta subunit
b1714	4	27	-1.621914	phenylalanine tRNA synthetase, alpha subunit
b1715	0	21	-6.610500	phenylalanyl-tRNA synthetase operon leader
b1716	-1	20	-6.461483	50S ribosomal subunit protein L20
b1717	-1	20	-6.083277	50S ribosomal subunit protein L35
b1718	-1	19	-4.964248	translation initiation factor IF-3
b1719	0	21	-5.299950	threonyl-tRNA synthetase
b4494	1	29	-5.545601	uncharacterized protein
b4535	1	20	-1.958552	acid-inducible putative outer membrane protein
b1722	0	20	-1.609065	6-phosphofructokinase II
b1723	0	19	-1.289540	uncharacterized protein
b1724	1	17	-1.440674	fructosamine kinase family protein
b1725	0	20	-3.553737	putative inner membrane protein
b1726	0	20	-4.062882	2-deoxyglucose-6-P phosphatase
b1727	-1	15	-2.087055	inner membrane protein regulated by LexA
b1728	-1	13	-2.092069	putative transporter
b1729	-2	13	-2.813825	uncharacterized protein
b1730	-1	16	-4.585614	cell division modulator
b1731	-2	13	-2.740050	catalase HPII, heme d-containing
b1732	-1	12	-2.826750	chito-oligosaccharide deacetylase
b1733	0	18	-4.546238	phospho-chitobiase; general
b1734	0	17	-5.063255	repressor of chb operon for
b1735	0	17	-4.504040	N,N'-diacetylchitobiose-specific enzyme IIA
b1736	1	18	-2.382231	N,N'-diacetylchitobiose-specific enzyme IIC
b1737	2	16	-2.087370	N,N'-diacetylchitobiose-specific enzyme IIB
b1738	1	15	-1.727460	osmotically-inducible lipoprotein
b1739	0	13	-0.473273	NAD synthetase, NH3/glutamine-dependent
b1740	0	12	0.758825	endonuclease of nucleotide excision repair
b1741	0	12	2.614570	cold- and stress-inducible protein
b1742	0	12	3.326850	periplasmic ATP-independent protein refolding
b1743	-1	11	3.589312	succinylglutamate desuccinylase
b1744	-1	12	3.677710	succinylarginine dihydrolase
b1745	0	11	3.196363	succinylglutamic semialdehyde dehydrogenase
b1746	0	11	2.312322	arginine succinyltransferase
b1747	-1	13	0.830612	succinylornithine transaminase, PLP-dependent
b1748	0	13	0.509638	exonuclease III
b1749	1	15	0.818531	TVP38/TMEM64 family inner membrane protein
b1750	3	17	1.885862	putative ferrodoxin-like lipoprotein
b1751	3	16	2.313411	TVP38/TMEM64 family inner membrane protein
b1752	3	14	2.833667	carboxymuconolactone decarboxylase family
b1753	3	15	3.083357	putative ABC transporter periplasmic binding
b1754	3	14	2.950714	putative ABC transporter permease
b1755	2	14	2.322860	putative ABC transporter ATPase

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1712	DNABINDINGHU	47	1e-11	Prokaryotic integration host factor signature.
>DNABINDINGHU#Prokaryotic integration host factor signature. Length = 91 Score = 47.4 bits (113), Expect = 1e-11 Identities = 10/41 (24%), Positives = 20/41 (48%) Query: 4 TKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQV 44 K ++ + + L+K+D+ V+ F + L GE+V Sbjct: 3 NKQDLIAKVAEATELTKKDSAAAVDAVFSAVSSYLAKGEKV 43

b1766

b4675

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1766	-1	14	-3.090973	cytoplasmic L-asparaginase 1
b1767	0	19	-4.630347	nicotinamidase/pyrazinamidase
b1768	0	22	-5.625928	putative MFS sugar transporter, membrane
b1769	0	24	-6.280379	putative DNA-binding transcriptional regulator
b1770	0	24	-5.331788	methylglyoxal reductase, NADH-dependent
b1771	0	21	-4.261232	putative kinase
b1772	1	22	-4.425207	putative aldolase
b1773	1	21	-3.943309	putative Zn-dependent NAD(P)-binding
b1774	-1	18	-3.136245	putative MFS sugar transporter, membrane
b1775	-1	17	-2.530374	putative Zn-dependent NAD(P)-binding
b1776	0	19	-2.266029	DUF1315 family protein
b1777	0	22	-1.843807	methionine sulfoxide reductase B
b1778	2	18	-1.569459	glyceraldehyde-3-phosphate dehydrogenase A
b1779	1	16	-1.679677	D-hexose-6-phosphate epimerase-like protein
b1780	-1	10	-4.057675	aldo-keto reductase, methylglyoxal to acetol,
b1781	-1	12	-4.630145	scaffolding protein for murein synthesizing
b1782	0	12	-4.728035	protein kinase, endogenous substrate
b1783	0	14	-5.353741	UPF0229 family protein
b1784	-2	18	-5.979854	putative membrane-anchored diguanylate cyclase
b1785	-2	22	-6.167852	putative diguanylate cyclase
b1786	-1	21	-2.008606	aminoacyl-tRNA editing domain protein
b1787	0	22	-0.053901	uncharacterized protein
b1788	1	22	0.071356	UPF0756 family putative inner membrane protein
b1789	0	20	-0.667336	putative DNA-binding transcriptional regulator
b1790	0	22	-1.334697	putative MFS transporter, inner membrane
b1791	-1	21	-1.358045	DUF488 family protein
b1792	-1	24	-3.159596	DUF333 family outer membrane lipoprotein
b1793	0	24	-4.149053	diguanylate cyclase
b1794	0	23	-4.655052	inner membrane-associated protein
b4676	2	23	-5.987109	inner membrane-associated protein
b4675	0	22	-3.366441	UPF0410 family protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1768	ISCHRISMTASE	25	0.006	Isochorismatase signature.
>ISCHRISMTASE#Isochorismatase signature. Length = 312 Score = 25.4 bits (55), Expect = 0.006 Identities = 12/44 (27%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Query: 2 PPRALLLV-DLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRG 44 P RA+LL+ D+QN F +L + C G Sbjct: 28 PNRAVLLIHDMQNYFVDAFTAGASPVTELSANIRKLKNQCVQLG 71
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1770	ARGREPRESSOR	23	0.032	Bacterial arginine repressor signature.
>ARGREPRESSOR#Bacterial arginine repressor signature. Length = 149 Score = 23.3 bits (50), Expect = 0.032 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Query: 1 MAAKDRIQAIKQMVANDKKVTVSNLSGI-----FQVTEETIRRDLEKL 43 M R I++++ ++ T L I + VT+ T+ RD+++L Sbjct: 1 MNKGQRHIKIREIITANEIETQDELVDILKKDGYNVTQATVSRDIKEL 48
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1795	HTHTETR	29	3e-04	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 29.2 bits (65), Expect = 3e-04 Identities = 9/37 (24%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Query: 4 LSWIIFGLIAGILAKWIMPG-----KDGGGFFMTILL 35 + I+ G I+G++ W+ K ++ ILL Sbjct: 163 AAIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILL 199

b1921

b2004

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1921	2	13	-1.631814	RpoS antagonist; putative regulator of FliA
b1922	-1	11	-1.393815	RNA polymerase, sigma 28 (sigma F) factor
b1923	-1	12	-1.387063	flagellar filament structural protein
b1924	-2	16	0.461560	flagellar filament capping protein
b1925	-1	14	0.256217	flagellar protein potentiates polymerization
b1926	0	14	0.429440	putative flagellar synthesis and assembly
b1927	0	14	-0.073600	cytoplasmic alpha-amylase
b1928	1	21	-4.288144	lipoprotein
b1929	1	23	-5.194322	UPF0394 family sulphur transport
b1930	2	32	-7.748792	putative TusA family sulfurtransferase
b1931	-1	23	-4.018705	DUF159 family protein
b1932	1	17	-2.951168	GNAT family putative N-acetyltransferase
b4495	1	15	-1.641705	flagellar basal-body component
b1936	0	15	4.154652	flagellar basal-body MS-ring and collar protein
b1937	1	15	3.973545	flagellar motor switching and energizing
b1938	1	14	3.897287	negative regulator of FliI ATPase activity
b1939	2	16	4.045475	flagellum-specific ATP synthase
b1940	0	17	3.594171	flagellar protein
b1941	-1	18	3.332176	flagellar hook-length control protein
b1942	-1	16	2.054675	flagellar biosynthesis protein
b1943	-1	16	2.164939	flagellar motor switching and energizing
b1944	-3	20	1.563191	flagellar motor switching and energizing
b1945	0	16	0.265721	flagellar biosynthesis protein
b1946	0	16	-2.844432	flagellar biosynthesis protein
b1947	0	17	-3.542428	flagellar biosynthesis protein
b1948	0	19	-4.330579	flagellar export pore protein
b1949	0	21	-4.469966	transcriptional regulator of colanic acid
b1950	-2	16	-3.088620	uncharacterized protein
b1951	0	19	-2.606859	uncharacterized protein
b1952	-2	16	-0.019533	putative mannosyl-3-phosphoglycerate
b1953	-3	16	0.351110	putative membrane-anchored diguanylate cyclase
b1955	-2	16	0.874019	uncharacterized protein
b1956	0	17	0.822503	DUF808 family inner membrane protein
b1957	2	17	1.563311	amino acid exporter for phenylalanine,
b1958	2	17	1.318372	DNA mismatch endonuclease of very short patch
b1959	-1	14	-0.422567	DNA cytosine methyltransferase
b1960	-1	14	-1.313489	putative HD superfamily phosphohydrolase
b1961	-2	19	-4.265217	inner membrane protein
b1962	0	27	-5.892075	glyoxalase III and Hsp31 molecular chaperone
b1963	1	31	-7.465718	putative sensory kinase in two-component
b4496	0	28	-6.420695	response regulator family protein
b1967	1	28	-6.157294	hydroxyisourate hydrolase
b1968	2	33	-7.701945	membrane-anchored, periplasmic TMAO, DMSO
b1969	2	27	-6.410192	inner membrane heme subunit for periplasmic
b1970	2	27	-6.218033	zinc and cadmium binding protein, periplasmic
b1971	0	19	-3.180505	cytochrome b561 homolog
b1972	0	23	-4.477345	*anti-repressor for DgsA(Mlc)
b1973	0	23	-4.158500	*putative adhesin
b1974	-1	21	-3.352269	shikimate transporter
b1976	-1	22	-3.579331	AMP nucleosidase
b1978	0	21	-3.304858	UPF0082 family protein
b4497	-2	29	-4.816161	*putative multdrug exporter, MATE family
b1981	-2	26	-3.392156	*ssuEADCB/tauABCD operon transcriptional
b1982	-1	29	-3.623442	nitrogen assimilation regulon transcriptional
b1983	0	31	-3.560580	*L,D-transpeptidase linking Lpp to murein
b1985	1	29	-1.941942	nicotinate-nucleotide--dimethylbenzimidazole
b1987	1	30	-1.727798	cobalamin synthase
b1988	2	30	-1.495618	cobinamide kinase and cobinamide phosphate
b1990	3	22	-0.039859	IS5 transposase and trans-activator
b1991	4	23	-0.907945	IS2 transposase TnpB
b1992	5	22	-1.584572	IS2 repressor TnpA
b1993	6	26	-3.090031	CP4-44 prophage; antigen 43 (Ag43)
b4639	3	27	-1.511360	CP4-44 prophage; putative membrane protein
b1994	4	26	-0.976755	CP4-44 prophage; putative DNA repair protein
b4640	3	31	-0.887039	CP4-44 prophage; uncharacterized protein
b4641	8	24	4.247892	CP4-44 prophage; cytoskeleton bundling-enhancing
b4582	7	23	3.308780	CP4-44 prophage; toxin of the YeeV-YeeU
b1996	8	24	3.947643	UPF0265 family protein
b1997	8	25	3.941449	putative transporter, FUSC family inner membrane
b1999	9	25	4.186947	DNA gyrase inhibitor
b2000	8	25	3.794175	D-alanyl-D-alanine carboxypeptidase;
b2001	6	23	0.821575	exodeoxyribonuclease I; exonuclease I
b2002	8	28	2.951515	putative TusA family sulfurtransferase
b2003	7	27	0.399119	UPF0394 family inner membrane protein
b2004	3	28	-0.591399	putrescine importer, low affinity

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1923	FLAGELLIN	44	1e-09	Flagellin signature.
>FLAGELLIN#Flagellin signature. Length = 507 Score = 44.3 bits (104), Expect = 1e-09 Identities = 38/43 (88%), Positives = 43/43 (100%) Query: 2 AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDD 44 AQVINTNSLSL+TQNN+NK+QS+LSS+IERLSSGLRINSAKDD Sbjct: 1 AQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDD 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1930	PF01206	54	2e-14	SirA family protein
>PF01206#SirA family protein Length = 76 Score = 54.0 bits (130), Expect = 2e-14 Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 7 DYRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCP 44 D LD G CP P + + + + GE+L V++ P Sbjct: 5 DQSLDATGLNCPLPILKAKKTLATMNAGEVLYVMATDP 42
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1937	FLGHOOKFLIE	52	3e-13	Flagellar hook-basal body complex protein FliE signa...
>FLGHOOKFLIE#Flagellar hook-basal body complex protein FliE signature. Length = 103 Score = 52.0 bits (124), Expect = 3e-13 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 2 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR 44 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR Sbjct: 1 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1938	FLGMRINGFLIF	62	6e-16	Flagellar M-ring protein signature.
>FLGMRINGFLIF#Flagellar M-ring protein signature. Length = 559 Score = 61.9 bits (150), Expect = 6e-16 Identities = 33/42 (78%), Positives = 39/42 (92%) Query: 3 ATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAK 44 +TA Q K LEWLNRLRANP+IPLIVAGSAAVA++VA++LWAK Sbjct: 5 STATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAK 46
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1939	FLGMOTORFLIG	58	2e-14	Flagellar motor switch protein FliG signature.
>FLGMOTORFLIG#Flagellar motor switch protein FliG signature. Length = 344 Score = 57.9 bits (140), Expect = 2e-14 Identities = 19/44 (43%), Positives = 34/44 (77%) Query: 1 MSNLTGTDKSVILLMTIGEDRAAEVFKHLSQREVQTLSAAMANV 44 +S LTG K+ ILL++IG + +++VFK+LSQ E+++L+ +A + Sbjct: 12 VSALTGKQKAAILLVSIGSEISSKVFKYLSQEEIESLTFEIAKL 55
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1940	FLGFLIH	74	8e-21	Flagellar assembly protein FliH signature.
>FLGFLIH#Flagellar assembly protein FliH signature. Length = 228 Score = 74.1 bits (181), Expect = 8e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL 44 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL Sbjct: 1 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1942	FLGFLIJ	68	5e-19	Flagellar FliJ protein signature.
>FLGFLIJ#Flagellar FliJ protein signature. Length = 147 Score = 67.9 bits (165), Expect = 5e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID 44 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID Sbjct: 1 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1943	FLGHOOKFLIK	58	1e-14	Flagellar hook-length control protein signature.
>FLGHOOKFLIK#Flagellar hook-length control protein signature. Length = 375 Score = 58.3 bits (140), Expect = 1e-14 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD 44 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD Sbjct: 1 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1945	FLGMOTORFLIM	48	5e-11	Flagellar motor switch protein FliM signature.
>FLGMOTORFLIM#Flagellar motor switch protein FliM signature. Length = 344 Score = 48.4 bits (115), Expect = 5e-11 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Query: 5 ILSQAEIDALLNGDS--EVKDEPTASVSGESDIRPYDPNTQR 44 +LSQ EID LL S + E +S I YD Sbjct: 4 VLSQDEIDQLLTAISSGDASIEDARPISDTRKITLYDFRRPD 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1946	FLGMOTORFLIN	80	7e-24	Flagellar motor switch protein FliN signature.
>FLGMOTORFLIN#Flagellar motor switch protein FliN signature. Length = 137 Score = 79.9 bits (197), Expect = 7e-24 Identities = 32/44 (72%), Positives = 41/44 (93%) Query: 1 MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGG 44 MSDMNNP+D+N GA+DDLWA+AL+EQK+T++KSAA+ VFQQ GG Sbjct: 1 MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGG 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1948	FLGBIOSNFLIP	59	5e-15	Escherichia coli: Flagellar biosynthetic protein Fl...
>FLGBIOSNFLIP#Escherichia coli: Flagellar biosynthetic protein FliP signature. Length = 245 Score = 59.1 bits (143), Expect = 5e-15 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT 44 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT Sbjct: 1 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1949	RTXTOXINA	31	6e-05	Gram-negative bacterial RTX toxin determinant A family...
>RTXTOXINA#Gram-negative bacterial RTX toxin determinant A family signature. Length = 1024 Score = 31.1 bits (70), Expect = 6e-05 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 10 GTEAMKVALALAAPL-LLVALVTGLIISILQAATQ 43 G A + AP+ LV VTG+I IL+A+ Q Sbjct: 381 GISAAATTSLVGAPVSALVGAVTGIISGILEASKQ 415
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1950	TYPE3IMRPROT	52	2e-12	Type III secretion system inner membrane R protein ...
>TYPE3IMRPROT#Type III secretion system inner membrane R protein family signature. Length = 261 Score = 51.7 bits (124), Expect = 2e-12 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL 44 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL Sbjct: 1 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1969	HTHFIS	28	0.001	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 27.9 bits (62), Expect = 0.001 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 2 KILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGL 37 IL+ +D+ + + Q LS AGY + S+ Sbjct: 5 TILVADDDAAIRTVLNQALSRAGYDVRITSNAATLW 40
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2012	PF01206	37	1e-07	SirA family protein
>PF01206#SirA family protein Length = 76 Score = 37.0 bits (86), Expect = 1e-07 Identities = 12/41 (29%), Positives = 21/41 (51%) Query: 4 KKLDVVTQVCPFPLIEAKAALAEMVSGDELVIEFDCTQATE 44 + LD CP P+++AK LA M +G+ L + + + Sbjct: 6 QSLDATGLNCPLPILKAKKTLATMNAGEVLYVMATDPGSVK 46

b2017

b2054

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2017	0	19	3.073344	6-phosphogluconate dehydrogenase,
b2018	0	21	3.611468	IS5 transposase and trans-activator
b2019	-1	21	3.946780	lipopolysaccharide biosynthesis protein
b2020	-1	20	3.669707	putative lipopolysaccharide biosynthesis
b2021	-1	24	2.860743	d-Galf:alpha-d-Glc
b2022	-2	17	0.893764	O-antigen polymerase
b2024	-1	14	-2.107799	UDP-galactopyranose mutase, FAD/NAD(P)-binding
b2026	2	13	-3.334861	putative polisoprenol-linked O-antigen
b2027	2	16	-7.025926	dTDP-4-deoxyrhamnose-3,5-epimerase
b2028	2	19	-7.649117	glucose-1-phosphate thymidylyltransferase
b2029	4	25	-9.057101	dTDP-L-rhamnose synthase, NAD(P)-dependent
b4571	6	39	-13.379330	dTDP-glucose 4,6 dehydratase, NAD(P)-binding
b2030	7	41	-13.786721	putative regulatory subunit for GalU
b2032	8	51	-17.031849	colanic acid biosynthesis protein
b2033	8	52	-16.072742	putative glycosyl transferase
b2034	7	50	-15.519882	colanic acid biosynthesis protein
b2035	4	47	-13.885111	putative colanic acid exporter
b2036	2	44	-11.674198	colanic biosynthesis UDP-glucose lipid carrier
b2037	1	36	-8.919956	phosphomannomutase
b2038	-1	23	-6.262005	mannose-1-phosphate guanyltransferase
b2039	-2	15	-3.882064	putative glycosyl transferase
b2040	-3	13	-1.998743	GDP-mannose mannosyl hydrolase
b2041	-2	11	-0.742665	bifunctional GDP-fucose synthetase:
b2042	-1	18	0.954627	GDP-D-mannose dehydratase, NAD(P)-binding
b2043	-1	21	1.460050	putative acyl transferase
b2044	-1	22	2.848275	putative glycosyl transferase
b2045	0	23	2.950379	putative colanic acid polymerase
b2046	-1	23	3.016740	putative glycosyl transferase
b2047	-1	23	3.401355	putative acyl transferase
b2048	-1	23	3.459223	putative glycosyl transferase
b2049	-1	20	2.811783	colanic acid production tyrosine-protein kinase;
b2050	-1	17	1.320501	colanic acid production
b2051	-1	14	-1.922516	colanic acid export protein; outer membrane
b2052	-1	15	-1.534529	inner membrane protein
b2054	1	16	-3.138018	suppressor of OmpF assembly mutants; putative

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2033	TYPE3IMSPROT	25	0.011	Type III secretion system inner membrane S protein ...
>TYPE3IMSPROT#Type III secretion system inner membrane S protein family signature. Length = 354 Score = 24.7 bits (54), Expect = 0.011 Identities = 6/32 (18%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Query: 2 ILKLAKRYGLCGFIRLVRDVLLTRVFYRNCRI 33 + K+A+ G + +++ + L R Y + + Sbjct: 295 VRKIAEEEG----VPILQRIPLARALYWDALV 322
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2041	NUCEPIMERASE	41	2e-08	Nucleotide sugar epimerase signature.
>NUCEPIMERASE#Nucleotide sugar epimerase signature. Length = 334 Score = 40.9 bits (96), Expect = 2e-08 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 1 MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLT 35 MK LVTG AGFIG V + ++ VV +D L Sbjct: 1 MKYLVTGAAGFIGFHVSKRLLEAG-HQVVGIDNLN 34
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2053	NUCEPIMERASE	33	1e-05	Nucleotide sugar epimerase signature.
>NUCEPIMERASE#Nucleotide sugar epimerase signature. Length = 334 Score = 33.2 bits (76), Expect = 1e-05 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 6 LITGVTGQDGSYLAEFLLEKGYEVHGI 32 L+TG G G ++++ LLE G++V GI Sbjct: 4 LVTGAAGFIGFHVSKRLLEAGHQVVGI 30
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2064	BCTERIALGSPH	23	0.031	Bacterial general secretion pathway protein H signa...
>BCTERIALGSPH#Bacterial general secretion pathway protein H signature. Length = 170 Score = 23.4 bits (50), Expect = 0.031 Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 2 RRFLTTLMILLVVLVAGLSALVLLVNPNDFRDYMVKQVAAR 42 +R T L ++L++L+ G+SA ++L+ RD Q AR Sbjct: 3 QRGFTLLEMMLILLLMGVSAGMVLLAFPASRDDSAAQTLAR 43

b2089

b2109

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2089	2	24	-2.252009	fructose-bisphosphate aldolase class I
b2091	3	22	-2.595472	nucleoside transporter, low affinity
b2092	1	18	-2.119106	ADP-ribosylglycohydrolase family protein
b2093	0	11	-2.393258	putative kinase
b2094	1	12	-0.971960	putative DNA-binding transcriptional regulator
b2095	1	10	0.523794	putative family 25 glycosyl hydrolase
b2097	2	12	0.422723	hydroxy-methylpyrimidine kinase and
b2099	0	14	1.930330	hydoxyethylthiazole kinase
b2101	-1	13	-0.010239	transcriptional repressor of rcnA
b2102	-1	14	-0.101737	membrane protein conferring nickel and cobalt
b2103	3	22	-2.656215	periplasmic modulator of Ni and Co efflux
b2104	3	27	-5.117928	putative fimbrial-like adhesin protein
b2105	3	28	-7.087946	putative outer membrane protein
b2106	3	29	-7.640543	putative periplasmic pilin chaperone
b2107	4	33	-8.769733	putative fimbrial-like adhesin protein
b2108	2	28	-7.183298	DUF2574 family protein
b2109	-1	13	-3.949804	antiporter inner membrane protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2107	TYPE3OMGPROT	24	0.018	Type III secretion system outer membrane G protein ...
>TYPE3OMGPROT#Type III secretion system outer membrane G protein family signature. Length = 607 Score = 24.1 bits (52), Expect = 0.018 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 6 KMLLGALLLVTSAAWAAPA 24 ++L G LLL++S +WA Sbjct: 11 RVLTGTLLLLSSYSWAQEL 29

b2120

b2144

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2120	2	16	1.274564	inner membrane putative sensory kinase in
b2121	0	14	-0.292163	transcriptional activator of csgD and csgBA
b2122	0	15	-0.658036	putative membrane protein
b2123	-1	15	-2.190780	putative ABC transporter permease
b2124	-1	15	-0.146796	putative ABC transporter ATPase
b2125	-1	17	0.755581	putative ABC transporter permease
b2126	1	17	2.245656	putative ABC transporter periplasmic binding
b2127	3	19	3.522313	beta-D-glucoside glucohydrolase, periplasmic
b2128	-1	14	2.808406	D-lactate dehydrogenase, FAD-binding, NADH
b2129	-2	15	2.080721	D-alanyl-D-alanine endopeptidase
b2130	-2	14	1.907343	Yip1 family inner membrane protein
b2131	-3	14	1.355852	DedA family inner membrane protein
b2132	-2	16	1.457531	putative oxidoreductase
b2133	0	14	1.548278	uncharacterized protein
b2134	2	17	1.647749	tRNA-dihydrouridine synthase C
b2135	1	20	2.397721	UPF0299 family inner membrane protein
b2136	2	19	2.029767	LrgB family inner membrane protein
b2137	2	17	1.890297	cytidine/deoxycytidine deaminase
b2139	1	14	1.843243	DUF218 superfamily vancomycin high temperature
b4679	0	14	0.139044	DUF2542 family protein
b2140	1	12	-0.043395	dihydropyrimidine dehydrogenase, NADH-dependent,
b2141	1	16	-0.683242	dihydropyrimidine dehydrogenase, NADH-dependent,
b2142	1	14	-0.567890	methyl-galactoside transporter subunit
b2143	0	12	-1.046583	methyl-galactoside ABC transporter ATPase
b2144	3	16	-3.008546	methyl-galactoside transporter subunit

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2150	ECOLIPORIN	24	0.026	E.coli/Salmonella-type porin signature.
>ECOLIPORIN#E.coli/Salmonella-type porin signature. Length = 383 Score = 23.7 bits (51), Expect = 0.026 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Query: 1 MNKKVLTLSAVMASMLFGAAAHAADTRIGVTIYKYDDN 38 M +KVL L V+ ++L AAHAA+ IY D N Sbjct: 1 MKRKVLAL--VIPALLAAGAAHAAE------IYNKDGN 30

b2192

b2205

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b2192	2	18	3.173737	periplasmic heme chaperone
b2194	1	22	3.705059	cytochrome c biogenesis protein; heme export ABC
b2195	1	21	4.110907	heme export ABC transporter permease;
b2196	0	18	4.284117	heme export ABC transporter permease
b2197	0	16	2.887959	heme export ABC transporter ATPase
b2198	0	16	3.174441	quinol dehydrogenase, electron source for NapAB
b2199	0	15	3.255128	nitrate reductase, small, cytochrome C550
b2200	-1	17	3.925424	ferredoxin-type protein
b2201	-1	19	4.061155	ferredoxin-type protein
b2202	0	22	3.991391	nitrate reductase, periplasmic, large subunit
b2203	0	20	4.434732	assembly protein for periplasmic nitrate
b2204	0	19	3.869130	ferredoxin-type protein, role in electron
b2205	1	19	3.388177	ecotin, a serine protease inhibitor

b4544

b2283

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4544	1	15	3.303781	O-succinylbenzoyl-CoA synthase
b2258	0	14	3.581030	dihydroxynaphthoic acid synthetase
b2259	1	14	4.795621	2-succinyl-6-hydroxy-2,
b2260	1	14	4.566449	2-succinyl-5-enolpyruvyl-6-hydroxy-3-
b2261	0	14	4.417939	isochorismate synthase 2
b2262	-1	14	3.201036	putative membrane-anchored DUF883 family
b2263	0	13	2.387531	GNAT family putative N-acetyltransferase
b2264	-1	17	-1.750030	RNase BN, tRNA processing enzyme
b2265	0	22	-4.849548	protease, capable of cleaving an AMC-ubiquitin
b2266	1	26	-6.666958	Von Willebrand factor domain putative
b2267	1	27	-6.985284	putative M28A family peptidase
b2268	1	29	-7.900657	DUF1877 family protein
b2269	2	33	-9.313209	uncharacterized protein
b2270	2	33	-7.495646	uncharacterized protein
b2271	1	21	-4.697758	TPR-like repeats-containing protein
b2272	1	14	-2.217826	NADH:ubiquinone oxidoreductase, membrane subunit
b2273	1	15	0.113958	NADH:ubiquinone oxidoreductase, membrane subunit
b2274	1	18	1.692493	NADH:ubiquinone oxidoreductase, membrane subunit
b2275	1	22	2.584830	NADH:ubiquinone oxidoreductase, membrane subunit
b2276	1	28	4.070171	NADH:ubiquinone oxidoreductase, membrane subunit
b2277	1	29	3.450924	NADH:ubiquinone oxidoreductase, chain I
b2278	1	30	4.013994	NADH:ubiquinone oxidoreductase, membrane subunit
b2279	0	30	3.711749	NADH:ubiquinone oxidoreductase, chain G
b2280	0	29	3.726804	NADH:ubiquinone oxidoreductase, chain F
b2281	1	28	3.919077	NADH:ubiquinone oxidoreductase, chain E
b2282	0	27	3.682575	NADH:ubiquinone oxidoreductase, fused CD
b2283	1	26	3.729612	NADH:ubiquinone oxidoreductase, chain B

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2267	AUTOINDCRSYN	28	0.001	Autoinducer synthesis protein signature.
>AUTOINDCRSYN#Autoinducer synthesis protein signature. Length = 216 Score = 27.9 bits (62), Expect = 0.001 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 1 MIEWQDLHHSELSVSQLYALLQLRCAVFV 29 M+E D++H+ LS ++ L LR F Sbjct: 1 MLEIFDVNHTLLSETKSGELFTLRKETFK 29
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2270	SSPAKPROTEIN	24	0.027	Invasion protein B family signature.
>SSPAKPROTEIN#Invasion protein B family signature. Length = 133 Score = 23.7 bits (51), Expect = 0.027 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 1 MRNKNIIMLLMSSLILSGCGP 21 M N N++ L+ SL GC P Sbjct: 1 MSNINLVQLVRDSLFTIGCPP 21

b2342

b2374

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2342	-1	17	-3.154273	uncharacterized protein
b2344	1	21	-5.337568	ABC transporter maintaining OM lipid asymmetry,
b2345	2	26	-7.431476	putative inner membrane protein
b2346	1	30	-9.815617	*CPS-53 (KpLE1) prophage; putative prophage
b2347	2	33	-10.627320	CPS-53 (KpLE1) prophage; bactoprenol-linked
b2349	4	38	-11.719528	CPS-53 (KpLE1) prophage; bactoprenol glucosyl
b2350	5	41	-12.424403	serotype-specific glucosyl transferase, CPS-53
b2351	4	40	-12.094198	CPS-53 (KpLE1) prophage; conserved protein
b2353	2	19	-0.407025	CPS-53 (KpLE1) prophage; uncharacterized
b2354	2	17	-0.793387	CPS-53 (KpLE1) prophage; uncharacterized
b2355	2	18	-1.411708	CPS-53 (KpLE1) prophage; uncharacterized
b2356	1	18	-2.156502	CPS-53 (KpLE1) prophage; conserved protein
b2357	2	20	-2.709805	CPS-53 (KpLE1) prophage; uncharacterized
b2358	1	22	-4.164890	CPS-53 (KpLE1) prophage; uncharacterized
b2359	2	24	-5.504339	response regulator inhibitor for tor operon
b2360	2	24	-6.333514	*dsd operon activator; autorepressor
b2361	1	26	-5.394350	D-serine transporter
b2362	2	22	-4.394668	D-serine dehydratase
b2363	2	20	-3.273752	putative multidrug efflux system
b4545	2	25	-4.921301	multidrug resistance efflux pump membrane fusion
b4501	1	27	-5.816452	response regulator in two-component regulatory
b2364	0	28	-6.286807	hybrid sensory histidine kinase in two-component
b2365	0	31	-8.311079	acetyl-CoA:oxalate CoA-transferase
b2366	0	34	-8.816216	putative transporter
b2367	1	36	-9.791158	oxalyl CoA decarboxylase, ThDP-dependent
b2368	0	35	-8.880601	formyl-CoA transferase, NAD(P)-binding
b2369	0	33	-8.192498	uncharacterized protein
b2370	1	33	-7.773450	putative lipoprotein involved in colanic acid
b2371	2	32	-5.987361	DUF2545 family putative inner membrane protein
b2372	2	32	-5.787525	palmitoleoyl-acyl carrier protein
b2373	1	26	-4.551891	inner membrane protein
b2374	-1	22	-4.388673	glutamate-pyruvate aminotransferase;

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2346	VACJLIPOPROT	80	9e-23	VacJ lipoprotein signature.
>VACJLIPOPROT#VacJ lipoprotein signature. Length = 251 Score = 79.6 bits (196), Expect = 9e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNF 44 MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNF Sbjct: 1 MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNF 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2375	ECOLIPORIN	28	8e-04	E.coli/Salmonella-type porin signature.
>ECOLIPORIN#E.coli/Salmonella-type porin signature. Length = 383 Score = 28.0 bits (62), Expect = 8e-04 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 1 MKRLIMATMVTAILASSTVWAAD 23 MKR ++A ++ A+LA+ AA+ Sbjct: 1 MKRKVLALVIPALLAAGAAHAAE 23

b2436

b2458

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b2436	-2	16	3.674463	CPZ-55 prophage; putative phage integrase
b2437	-3	17	3.417959	CPZ-55 prophage; uncharacterized protein
b2438	-2	18	2.470142	CPZ-55 prophage; uncharacterized protein
b2439	-2	19	1.821062	CPZ-55 prophage; uncharacterized protein
b2440	-1	20	0.891562	CPZ-55 prophage; uncharacterized protein
b2441	-1	25	-0.300815	CPZ-55 prophage; uncharacterized protein
b2442	0	33	-1.771906	CPZ-55 prophage; uncharacterized protein
b2443	1	34	-4.413724	CPZ-55 prophage; uncharacterized protein
b2444	1	32	-4.159201	CPZ-55 prophage; uncharacterized protein
b2445	2	34	-3.481767	reactivating factor for ethanolamine ammonia
b2446	-1	20	0.458495	ethanolamine transporter
b2447	-1	18	1.485365	ethanol dehydrogenase involved in ethanolamine
b2448	-1	14	2.748786	ethanolamine utilization protein, HSP70/actin
b2449	-1	15	4.070171	aldehyde oxidoreductase, ethanolamine
b2451	2	19	5.638865	Ethanolamine catabolic microcompartment shell
b2452	1	18	5.239049	ethanolamine utilization protein, putative
b2453	4	19	5.932645	phosphate acetyltransferase
b2454	2	18	5.865065	cobalamin adenosyltransferase involved in
b2455	3	19	5.419444	RmlC-like cupin domain protein
b2456	1	19	4.474185	putative P-loop NTPase ethanolamine utilization
b2457	2	20	4.198032	putative ethanol utilization carboxysome
b2458	2	17	3.308355	malic enzyme: putative

b2523

b2528

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2523	0	18	3.785626	aminopeptidase B
b2524	3	20	2.762002	Fe(2+) donor and activity modulator for cysteine
b2525	3	25	2.617200	[2Fe-2S] ferredoxin
b2526	2	25	2.714955	DnaK-like molecular chaperone specific for IscU
b2527	2	24	1.315234	HscA co-chaperone, J domain-containing protein
b2528	2	29	1.691547	FeS cluster assembly protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2526	SHAPEPROTEIN	24	0.018	Bacterial cell shape determinant MreB/Mbl protein s...
>SHAPEPROTEIN#Bacterial cell shape determinant MreB/Mbl protein signature. Length = 347 Score = 24.3 bits (53), Expect = 0.018 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 23 GIDLGTTNSLVA 34 IDLGT N+L+ Sbjct: 14 SIDLGTANTLIY 25

b2611

b2672

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b2611	3	12	-0.673901	cytochrome c assembly protein family inner
b4461	2	12	-0.923926	UPF0053 family inner membrane protein
b2614	3	14	-1.408000	heat shock protein
b2615	3	15	-1.239066	NAD kinase
b2616	2	19	-1.943874	recombination and repair protein
b2617	1	28	-6.089588	lipoprotein component of BamABCDE OM biogenesis
b2618	2	30	-6.361962	UPF0125 family protein
b2619	4	33	-8.911979	toxic UPF0083 family protein inhibitor of 70S
b2620	4	34	-9.649971	tmRNA-binding trans-translation protein
b2622	4	31	-8.132405	CP4-57 prophage; integrase
b2623	3	30	-7.675002	CP4-57 prophage; uncharacterized protein
b2624	3	29	-6.502880	CP4-57 prophage; DNA-binding transcriptional
b2625	4	29	-6.703178	CP4-57 prophage; uncharacterized protein
b2626	5	29	-5.001359	CP4-57 prophage; uncharacterized protein
b2627	4	27	-3.387452	radiation resistance protein; DEAD/H
b2628	4	23	-2.412329	CP4-57 putative defective prophage,
b2629	5	24	-0.770113	CP4-57 prophage; uncharacterized protein
b2630	4	24	-0.283994	CP4-57 prophage; RNase LS
b2631	4	22	1.890573	CP4-57 prophage; uncharacterized protein
b2632	4	24	2.382939	CP4-57 prophage; 50S ribosome-binding GTPase
b2633	4	23	1.907078	CP4-57 prophage; uncharacterized protein
b2634	4	26	1.765465	CP4-57 prophage; putative DNA-binding
b2635	2	31	-8.357979	CP4-57 prophage; putative inner membrane
b2636	2	32	-8.141564	CP4-57 prophage; uncharacterized protein
b2637	3	33	-7.762275	CP4-57 prophage; putative periplasmic protein
b2638	4	33	-7.385769	CP4-57 prophage; putative inner membrane
b2641	3	33	-6.886129	CP4-57 prophage; putative antirestriction
b2642	4	32	-8.928474	CP4-57 prophage; putative DNA repair protein
b4644	7	27	1.476600	uncharacterized protein
b2643	5	20	-1.561321	CP4-57 prophage; antitoxin of the YpjF-YfjZ
b2644	6	21	-1.868185	CP4-57 prophage; toxin of the YpjF-YfjZ
b4548	4	26	-5.236766	adhesin-like autotransporter
b2645	4	30	-7.736507	*carbon starvation protein
b2646	2	26	-7.050859	L-2-hydroxyglutarate oxidase
b2647	1	22	-5.607248	succinate-semialdehyde dehydrogenase I,
b2648	1	15	-5.089873	4-aminobutyrate aminotransferase, PLP-dependent
b2650	2	12	-3.296620	gamma-aminobutyrate transporter
b4462	3	13	-0.563538	transcriptional repressor of csiD
b2659	2	22	4.142559	uncharacterized protein
b2660	3	21	3.875524	cyaR sRNA-regulated protein
b2661	3	21	3.273720	tributyltin-inducible repressor of ygaVP
b2662	2	17	2.034895	DUF2892 family inner membrane rhodanese
b2663	2	17	-1.157701	DNA binding protein, nucleoid-associated
b2664	0	19	-1.923743	alanine exporter, alanine-inducible,
b2665	-1	20	-3.132579	uncharacterized protein
b2666	0	24	-3.354796	putative membrane-anchored DUF883 family
b2667	0	23	-2.756758	hydrogen donor for NrdEF electron transport
b2668	0	24	-2.821643	NrdEF cluster assembly flavodoxin
b2669	3	20	-0.769276	ribonucleoside-diphosphate reductase 2, alpha
b2670	1	12	-0.048543	ribonucleoside-diphosphate reductase 2, beta
b2671	1	13	-0.547886	glycine betaine/proline ABC transporter
b2672	2	14	-0.776763	glycine betaine/proline ABC transporter

b2707

b2728

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2707	1	14	3.489031	asc operon transcriptional repressor; prpBC
b2708	1	14	3.924442	cellobiose/arbutin/salicin-specific PTS enzymes,
b2709	0	15	3.402989	cryptic 6-phospho-beta-glucosidase
b2710	0	15	3.255886	protease involved in processing C-terminal end
b2711	0	14	2.926330	hydrogenase 3 maturation protein
b2712	-1	15	2.984069	hydrogenase 3 and formate hydrogenase complex,
b2713	-1	16	1.644127	formate hydrogenlyase complex iron-sulfur
b2714	0	17	2.160522	hydrogenase 3, large subunit
b2715	-1	19	2.490314	hydrogenase 3, membrane subunit
b2716	-1	24	2.829616	hydrogenase 3, membrane subunit
b2717	-1	28	4.485176	hydrogenase 3, Fe-S subunit
b2718	-1	26	5.215873	regulator of the transcriptional regulator FhlA
b2719	0	26	5.518348	protein involved in nickel insertion into
b2720	1	27	5.099266	GTP hydrolase involved in nickel liganding into
b2721	1	25	4.985959	hydrogenase maturation protein
b2722	3	22	4.682238	hydrogenase maturation protein
b2723	3	22	4.204397	carbamoyl dehydratase, hydrogenases 1,2,3
b2724	2	20	2.962583	formate hydrogenlyase transcriptional activator
b2725	1	19	3.190406	uncharacterized protein
b2726	0	15	2.684131	methyl-directed mismatch repair protein
b2727	0	15	2.532944	serine/threonine-specific protein phosphatase 2
b2728	-1	13	3.040668	DeoR family putative transcriptional regulator

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2714	HTHTETR	27	0.003	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 26.5 bits (58), Expect = 0.003 Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 2 TTMLEVAKRAGVSKATVSR 20 T++ E+AK AGV++ + Sbjct: 32 TSLGEIAKAAGVTRGAIYW 50

b2753

b2758

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b2753	0	36	-4.382869	CRISP RNA (crRNA) containing Cascade antiviral
b2754	1	40	-4.989625	Cascade complex anti-viral R-loop
b2755	1	40	-5.832816	phosphoadenosine phosphosulfate reductase; PAPS
b2756	2	40	-7.024564	sulfite reductase, beta subunit, NAD(P)-binding,
b2757	2	36	-6.459084	sulfite reductase, alpha subunit, flavoprotein
b2758	0	23	-4.459980	6-pyruvoyl tetrahydrobiopterin synthase (PTPS)

b4463

b2778

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4463	1	11	-3.057023	7-carboxy-7-deazaguanine synthase; queosine
b2774	2	15	-4.817607	membrane stress resistance protein
b2775	-1	15	-3.881425	TPM domain protein, putative phosphatase
b2776	0	19	-3.187629	enolase
b2777	0	22	-2.979541	CTP synthetase
b4682	1	27	-3.527209	nucleoside triphosphate pyrophosphohydrolase
b2778	2	27	-2.855953	mRNA interferase toxin, antitoxin is MazE

b2841

b2858

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b2841	0	16	-3.122052	arabinose transporter
b2842	2	20	-5.107467	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase;
b2843	2	26	-7.283421	hexuronate isomerase
b2844	1	31	-8.576099	short chain acyltransferase
b2845	2	37	-13.105068	putative transporter
b2846	4	47	-16.606038	putative LuxR family transcriptional regulator
b2847	5	46	-17.551931	putative transcriptional regulator
b2848	8	51	-18.669725	uncharacterized protein
b4683	9	52	-18.391619	uncharacterized protein
b2849	9	51	-18.139786	uncharacterized protein
b2850	8	51	-17.729644	SycD-like chaperone family TPR-repeat-containing
b2851	8	49	-18.061055	putative transcriptional regulator
b2852	8	51	-17.737502	uncharacterized protein
b2853	2	42	-12.342767	IS2 transposase TnpB
b2854	2	40	-10.580290	IS2 repressor TnpA
b2856	4	39	-9.534260	*LysM domain-containing M23 family putative
b2858	2	33	-7.006532	xanthine dehydrogenase, molybdenum binding

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b2842	DHBDHDRGNASE	30	1e-04	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase sig...
>DHBDHDRGNASE#2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature. Length = 261 Score = 30.4 bits (68), Expect = 1e-04 Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 3 LSAFSLEGKVAVVTGCDTGLGQGMALGLAQAGCDIVGIN 41 ++A +EGK+A +TG G+G+ +A LA G I ++ Sbjct: 1 MNAKGIEGKIAFITGAAQGIGEAVARTLASQGAHIAAVD 39

b2975

b2992

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b2975	-2	14	3.126953	putative ATP-binding protein
b2976	0	13	3.486998	putative ATP-binding protein
b2977	1	12	3.331458	putative ATP-binding protein
b4467	1	15	3.291328	phosphate transporter
b2979	0	17	2.198061	glutathionylspermidine amidase and
b2980	1	18	0.976989	putative S-transferase
b2981	1	17	-0.031400	hydrogenase 2 accessory protein
b2982	1	17	0.199316	protein involved with the maturation of
b2984	-1	11	-0.037143	hydrogenase 2-specific chaperone
b2986	-1	10	0.143128	maturation protease for hydrogenase 2
b2988	-1	15	1.480228	hydrogenase 2, large subunit
b2990	3	21	1.879836	putative hydrogenase 2 cytochrome b type
b2991	3	23	2.101536	hydrogenase 2 4Fe-4S ferredoxin-type component
b2992	2	23	2.115677	hydrogenase 2, small subunit

b3041

b3053

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3041	2	25	-1.039948	putative periplasmic pilin chaperone
b3042	1	27	-4.417209	fimbrial protein
b3043	3	30	-6.763404	motility and biofilm regulator
b3046	2	32	-6.515296	DUF1449 family inner membrane protein
b3044	3	31	-6.744266	PHB family membrane protein, function unknown
b3045	0	26	-5.602917	toxic membrane protein
b3047	1	30	-7.567250	toxic membrane protein
b3048	1	29	-6.520262	heptose 7-phosphate kinase and heptose
b3049	0	14	-1.411388	fused deadenylyltransferase/adenylyltransferase
b3051	1	10	2.416283	inorganic triphosphatase
b4664	0	14	3.268570	SH3 domain protein
b4666	-1	13	3.605039	fused tRNA nucleotidyl transferase/2'3'-cyclic
b3052	-1	14	3.429228	undecaprenyl pyrophosphate phosphatase
b3053	0	15	3.118662	dihydroneopterin aldolase and dihydroneopterin

b3114

b3120

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3114	0	14	-3.375880	L-threonine dehydratase, catabolic
b3115	0	20	-6.749143	tdc operon transcriptional activator
b3116	2	27	-10.522762	L-threonine dehydratase operon activator
b3118	0	27	-8.850112	uncharacterized protein
b3119	1	23	-7.076488	pentapetide repeats-related protein
b3120	0	16	-4.989587	glycerate kinase I

b3385

b3392

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3385	2	14	0.573053	cell division protein that binds to the septal
b3386	2	14	0.969356	3-dehydroquinate synthase
b3387	2	14	1.158610	shikimate kinase I
b3388	2	15	1.878850	DNA catabolic putative fimbrial transporter
b3389	1	18	1.838913	DNA catabolic protein
b3390	2	21	2.497930	DNA catabolic protein
b3391	-1	16	3.459986	DNA catabolic putative fimbrial assembly
b3392	-1	16	3.175132	DNA catabolic putative pilus assembly protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3390	PF05272	26	0.003	Virulence-associated E family protein
>PF05272#Virulence-associated E family protein Length = 892 Score = 26.2 bits (57), Expect = 0.003 Identities = 8/17 (47%), Positives = 9/17 (52%) Query: 9 LVGPMGAGKSTIGRQLA 25 L G G GKST+ L Sbjct: 601 LEGTGGIGKSTLINTLV 617

b3437

b4660

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3437	0	15	-4.158058	quercetinase activity in vitro
b3438	2	19	-5.871846	putative oxidoreductase
b3439	1	22	-7.473272	aminoacyl nucleotide detoxifying
b3440	1	27	-7.571761	putative Hcp1 family polymorphic toxin protein;
b3441	2	36	-9.615162	IS1 repressor TnpA
b3442	2	20	-5.575492	IS1 transposase B
b3443	1	14	-0.962264	stable heat shock chaperone
b3444	-1	15	2.175727	gamma-glutamyltranspeptidase
b3445	-1	18	3.064297	DUF2756 family protein
b3446	-1	19	3.009994	glycerophosphodiester phosphodiesterase,
b3447	-1	21	3.624534	sn-glycerol-3-phosphate ABC transporter ATPase
b3448	-1	23	3.328607	sn-glycerol-3-phosphate ABC transporter
b3449	-1	25	3.819275	sn-glycerol-3-phosphate ABC transporter
b3450	-1	26	3.652267	sn-glycerol-3-phosphate ABC transporter
b3451	-1	27	3.482299	branched-chain amino acid ABC transporter
b3452	-2	26	3.757008	branched-chain amino acid ABC transporter
b3453	-2	25	3.455506	branched-chain amino acid ABC transporter
b3454	-2	23	3.956232	branched-chain amino acid ABC transporter
b3455	-1	23	3.568148	leucine transporter subunit
b3456	-2	24	3.405398	PanD autocleavage accelerator, panothenate
b3457	-2	24	2.669890	branched-chain amino acid ABC transporter
b3458	-1	22	2.605141	RNA polymerase, sigma 32 (sigma H) factor
b3459	1	20	2.405968	putative ABC transporter permease
b3460	2	18	2.223344	cell division ATP-binding protein
b3461	2	16	1.675610	Signal Recognition Particle (SRP) receptor
b3462	2	13	1.359160	16S rRNA m(2)G966 methyltransferase,
b3463	3	12	1.927664	DUF1145 family protein
b3464	2	12	3.393258	DUF2500 family protein
b3465	0	15	3.913346	TMEM86 family putative inner membrane protein
b3466	0	14	3.398867	zinc, cobalt and lead efflux system
b3467	0	15	3.590042	mnm(5)-s(2)U34-tRNA 2-thiolation
b3468	-1	15	4.159095	DUF165 family inner membrane protein
b3469	0	15	3.285046	putative lipoprotein
b3470	1	17	1.877876	putative arabinose efflux transporter
b3471	0	15	1.772462	UPF0118 family putative transporter
b3472	0	16	2.857912	4'-phosphopantetheinyl transferase
b3473	0	18	3.921088	nickel/heme ABC transporter periplasmic binding
b3474	-1	20	4.174953	nickel ABC transporter permease
b3475	-1	23	5.084013	nickel ABC transporter permease
b3476	0	24	5.156944	nickel ABC transporter ATPase
b3477	2	26	6.836879	nickel ABC transporter ATPase
b3478	3	24	5.560609	transcriptional repressor, Ni-binding
b3479	2	22	4.023724	Rhs protein with DUF4329 family putative toxin
b3480	1	21	1.443059	putative NTF2 fold immunity protein for
b3481	2	22	1.332355	putative transposase
b3482	1	20	2.143554	putative ABC transporter permease
b3483	0	15	-0.189638	ribosome-associated ATPase: ATP-binding
b4552	1	15	-2.179628	putative membrane fusion protein (MFP) of efflux
b3484	1	19	-4.188902	DUF4049 family protein
b3485	1	18	-3.493829	acid resistance protein, inner membrane
b3486	-1	17	-3.383097	putative oxidoreductase
b3487	-1	21	-5.146514	phosphate transporter, low-affinity; tellurite
b3488	1	25	-6.815126	universal stress (ethanol tolerance) protein B
b4660	0	19	-4.517429	universal stress global response regulator

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3467	SHIGARICIN	26	0.005	Ribosome inactivating protein family signature.
>SHIGARICIN#Ribosome inactivating protein family signature. Length = 289 Score = 25.9 bits (57), Expect = 0.005 Identities = 6/21 (28%), Positives = 13/21 (61%) Query: 7 FFIVIIGLIVVAASFRFMQQR 27 +V+I AA ++F++Q+ Sbjct: 173 ALMVLIQSTSEAARYKFIEQQ 193
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3470	PF01206	57	2e-15	SirA family protein
>PF01206#SirA family protein Length = 76 Score = 56.7 bits (137), Expect = 2e-15 Identities = 16/36 (44%), Positives = 23/36 (63%) Query: 9 DHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIAD 44 D +LDA GL CP P++ +KT+ M GE L ++A Sbjct: 5 DQSLDATGLNCPLPILKAKKTLATMNAGEVLYVMAT 40
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3487	BCTERIALGSPF	24	0.025	Bacterial general secretion pathway protein F signa...
>BCTERIALGSPF#Bacterial general secretion pathway protein F signature. Length = 408 Score = 23.6 bits (51), Expect = 0.025 Identities = 5/23 (21%), Positives = 9/23 (39%) Query: 6 RHLAWWVVGLLAVAAIVAWWLLR 28 R W++ L + +LR Sbjct: 224 RTFGPWMLLALLAGFMAFRVMLR 246

b3502

b3511

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3502	1	18	-3.615461	putative Mg(2+) transport ATPase, inner membrane
b3503	2	19	-5.940499	acid-resistance protein
b3504	2	20	-7.103530	stress response protein acid-resistance protein
b3505	3	16	-5.218040	acid-resistance membrane protein
b3506	2	22	-7.970024	gad regulon transcriptional activator
b3507	1	23	-10.313195	anaerobic multidrug efflux transporter,
b3508	-2	21	-5.810726	anaerobic multidrug efflux transporter,
b3509	-2	13	-2.150454	transcriptional activator of gadA and gadBC;
b3510	-2	13	-2.550878	acid resistance regulon transcriptional
b3511	-2	16	-3.236906	glutamate decarboxylase A, PLP-dependent

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3514	ACRIFLAVINRP	68	5e-18	Acriflavin resistance protein family signature.
>ACRIFLAVINRP#Acriflavin resistance protein family signature. Length = 1034 Score = 67.9 bits (166), Expect = 5e-18 Identities = 32/44 (72%), Positives = 39/44 (88%) Query: 1 MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTIT 44 MAN+FI RP+FAWVLAII+M+AG LAI+ LPVAQYP IAPP ++ Sbjct: 1 MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVS 44

b3553

b3562

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3553	0	20	-3.544756	glycine tRNA synthetase, beta subunit
b3554	3	25	-5.819711	glycine tRNA synthetase, alpha subunit
b3555	7	35	-8.477381	uncharacterized protein
b3556	3	22	-2.281855	O-acetyltransferase for enterobacterial common
b4647	2	24	-0.949048	YiaAB family inner membrane protein, tandem
b4455	2	23	-0.648132	YiaAB family inner membrane protein
b3557	0	20	-0.994550	xylulokinase
b3558	0	20	-1.322974	D-xylose isomerase
b3559	-2	18	-0.637797	D-xylose transporter subunit
b4553	0	16	-2.379448	D-xylose ABC transporter dual domain ATPase
b3561	0	15	-3.258986	D-xylose ABC transporter permease
b3562	-2	16	-3.345530	xylose divergent operon transcriptional

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3564	SHAPEPROTEIN	24	0.031	Bacterial cell shape determinant MreB/Mbl protein s...
>SHAPEPROTEIN#Bacterial cell shape determinant MreB/Mbl protein signature. Length = 347 Score = 23.6 bits (51), Expect = 0.031 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 7/34 (20%) Query: 3 IGIDLGTSGVKV------ILLNEQGEVVAAQTEK 30 + IDLGT+ + I+LNE VVA + ++ Sbjct: 13 LSIDLGTANTLIYVKGQGIVLNEP-SVVAIRQDR 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3569	FLGHOOKAP1	23	0.034	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 23.4 bits (50), Expect = 0.034 Identities = 10/38 (26%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Query: 4 KRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFI 41 R + + V G G Y+ Q E+D FI Sbjct: 34 TRQTTIMAQANSTLGAGGWV-GNGVYVSGVQREYDAFI 70

b3588

b4650

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3588	-1	16	4.636373	TPR-like repeat protein
b3589	-1	13	2.973236	putative membrane fusion protein (MFP) component
b3590	0	15	2.793785	DUF3302 family inner membrane protein
b3591	1	19	1.179449	mannitol-specific PTS enzyme: IIA, IIB and IIC
b3592	2	22	0.288698	mannitol-1-phosphate dehydrogenase,
b3593	3	24	-0.579702	mannitol operon repressor
b3594	8	48	-13.277564	uncharacterized protein
b3595	9	45	-11.498202	ribosome-associated DUF2810 family protein
b3596	4	33	-9.026708	L-lactate permease
b4650	3	29	-6.108780	dual role activator/repressor for lldPRD operon

b3617

b3630

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3617	1	18	-5.544846	lipopolysaccharide 1,6-galactosyltransferase;
b3618	3	29	-9.769443	lipopolysaccharide rhamnose:KdoIII transferase;
b3619	3	30	-10.397513	kinase that phosphorylates core heptose of
b3620	4	39	-12.621132	UDP-glucose:(heptosyl)lipopolysaccharide
b3621	5	49	-16.139269	lipopolysaccharide core biosynthesis protein
b3623	5	48	-17.047569	3-deoxy-D-manno-octulosonic-acid transferase
b3624	5	47	-17.653943	pantetheine-phosphate adenylyltransferase
b3625	5	45	-16.078041	formamidopyrimidine/5-formyluracil/
b3626	4	44	-14.327073	50S ribosomal subunit protein L33
b3627	4	40	-12.471101	50S ribosomal subunit protein L28
b3628	2	32	-8.977524	UPF0758 family protein
b3629	3	28	-7.523213	fused 4'-phosphopantothenoylcysteine
b3630	0	21	-3.164835	deoxyuridinetriphosphatase

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3634	LPSBIOSNTHSS	77	3e-22	Lipopolysaccharide core biosynthesis protein signat...
>LPSBIOSNTHSS#Lipopolysaccharide core biosynthesis protein signature. Length = 166 Score = 76.8 bits (189), Expect = 3e-22 Identities = 22/40 (55%), Positives = 32/40 (80%) Query: 5 AIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKP 44 AIYPG+FDPIT GH+DI+ R ++FD V +A+ +P+K+P Sbjct: 3 AIYPGSFDPITFGHLDIIERGCRLFDQVYVAVLRNPNKQP 42

b3649

b3671

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3649	-2	14	3.140074	EamA family inner membrane putative transporter
b3650	-2	12	3.047911	cytoplasmic membrane lipoprotein-28
b3651	-1	12	2.608794	putative periplasmic protein
b3652	-1	12	1.852190	putative transporter
b3653	0	11	0.968770	DUF1198 family protein
b3654	-2	9	-0.138352	adenine permease, high affinity; adenine:H+
b3655	-2	11	-1.079401	cryptic adenine deaminase
b3656	-2	12	-2.361405	hexose phosphate transporter
b3657	-2	17	-4.028734	membrane protein regulates uhpT expression
b4653	0	19	-3.152938	sensory histidine kinase in two-component
b3659	0	19	-2.932997	response regulator in two-component regulatory
b3660	0	20	-2.421957	acetolactate synthase 1 small subunit
b3661	0	16	-0.742937	acetolactate synthase 2 large subunit
b4555	-1	11	0.115148	ilvB operon leader peptide
b3662	0	12	1.012187	toxic membrane persister formation peptide,
b3663	-1	12	1.811277	multidrug efflux system protein
b3664	-1	13	2.253310	putative Cys-type oxidative YidJ-maturating
b3665	-2	14	3.138710	inner membrane protein
b3666	0	17	3.564386	DUF202 family inner membrane protein
b3667	1	18	4.263967	inner membrane protein
b3669	2	19	4.252517	sulfatase/phosphatase superfamily protein
b3670	2	18	3.504064	putative transporter
b3671	2	16	3.558843	AraC family putative transcriptional regulator

b3715

b3735

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3715	1	16	-4.825458	phosphate ABC transporter permease
b3716	1	15	-4.578378	phosphate ABC transporter permease
b3717	1	13	-3.366340	phosphate ABC transporter periplasmic binding
b3718	1	13	-3.676748	L-glutamine:D-fructose-6-phosphate
b3719	0	12	-3.381564	fused N-acetyl glucosamine-1-phosphate
b3720	-1	12	-3.217168	F1 sector of membrane-bound ATP synthase,
b3721	-2	11	-1.314585	F1 sector of membrane-bound ATP synthase, beta
b3723	-3	21	-0.055702	F1 sector of membrane-bound ATP synthase, gamma
b3725	-1	28	1.585638	F1 sector of membrane-bound ATP synthase, alpha
b3726	-1	26	1.833454	F1 sector of membrane-bound ATP synthase, delta
b3727	2	32	1.717935	F0 sector of membrane-bound ATP synthase,
b3728	2	32	1.550317	F0 sector of membrane-bound ATP synthase,
b3729	3	36	1.813413	F0 sector of membrane-bound ATP synthase,
b3730	4	35	1.689068	ATP synthase, membrane-bound accessory factor
b3731	5	39	1.857766	16S rRNA m(7)G527 methyltransferase,
b3732	5	41	1.751743	5-methylaminomethyl-2-thiouridine modification
b3733	4	34	0.786594	FMN-binding protein MioC
b3734	5	35	0.565832	transcriptional activator of asnA;
b3735	3	20	-0.669639	asparagine synthetase A

b3766

b3771

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3766	0	17	3.011565	dihydroxyacid dehydratase
b4669	-1	18	3.994564	l-threonine dehydratase, biosynthetic; also
b4488	-1	17	4.349207	transcriptional activator of ilvC;
b3769	-1	24	4.205044	ketol-acid reductoisomerase, NAD(P)-binding
b3770	-1	26	4.289756	peptidyl-prolyl cis-trans isomerase C (rotamase
b3771	-1	22	3.550991	DNA helicase and single-stranded DNA-dependent

b4558

b3827

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4558	-1	19	4.177230	DNA-dependent ATPase I and helicase II
b3809	-1	17	3.267304	DUF2233 family protein
b3810	-1	18	2.889301	magnesium/nickel/cobalt transporter
b3811	-1	15	1.475907	DUF2628 family putative inner membrane protein
b3812	-1	13	-0.089421	PRK11371 family inner membrane protein
b3813	-1	12	-0.795362	putative chloramphenical resistance permease
b4482	-1	12	-4.280607	4HBT thioesterase family protein
b3816	0	12	-3.518084	outer membrane phospholipase A
b3817	1	14	-1.791951	ATP-dependent DNA helicase
b3818	1	14	-0.352007	threonine efflux pump
b3819	0	16	1.070737	homoserine, homoserine lactone and
b3820	-1	14	1.607325	lysophospholipase L2
b3821	-1	15	1.364656	pyridoxal phosphate phosphatase
b3822	0	15	2.020927	putative inner membrane EamA-like transporter
b3823	0	15	2.017982	methionine biosynthesis regulon transcriptional
b3825	0	15	3.173955	5-methyltetrahydropteroyltriglutamate-
b3826	0	16	3.260119	putative carboxymethylenebutenolidase
b3827	0	14	3.253076	uridine phosphorylase

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3821	PHPHLIPASEA1	86	5e-25	Bacterial phospholipase A1 protein signature.
>PHPHLIPASEA1#Bacterial phospholipase A1 protein signature. Length = 289 Score = 86.2 bits (213), Expect = 5e-25 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQ 44 MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQ Sbjct: 1 MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQ 44

b3843

b3874

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3843	-1	16	3.018138	proline dipeptidase
b3844	-2	18	2.884563	UPF0029 family protein
b3845	-1	19	2.848617	potassium transporter
b3846	-2	17	1.840719	protoporphyrin oxidase, flavoprotein
b3847	-2	13	0.765920	**molybdopterin-guanine dinucleotide biosynthesis
b3848	-1	14	-0.016980	molybdopterin-guanine dinucleotide synthase
b3849	0	16	-1.271463	DUF1040 protein YihD
b3850	-1	16	-2.761109	Cpx stress response Thr/Ser protein kinase; MazF
b3856	0	20	-5.502344	periplasmic protein disulfide isomerase I
b3858	-2	14	-3.926252	DUF945 family protein
b3860	0	13	-3.295909	inner membrane protein, inner membrane
b3861	0	10	-2.430661	5' to 3' DNA polymerase and 3' to 5'/5' to 3'
b3862	0	13	-0.646580	cell division GTP-binding protein
b3863	1	15	1.372310	activator of Der GTPase
b3865	0	16	2.480092	coproporphyrinogen III oxidase, SAM and NAD(P)H
b3866	0	17	2.427293	uncharacterized protein
b3867	2	24	2.355942	fused DNA-binding response regulator in
b4686	2	22	2.023596	sensory histidine kinase in two-component
b3868	2	18	0.742166	glutamine synthetase
b3869	1	18	-1.429557	GTP-binding protein
b3870	3	19	-3.129210	putative DNA-binding transcriptional regulator
b3871	2	14	-4.743938	putative sugar phosphate isomerase
b3872	0	13	-5.406918	MFS transporter family protein
b3873	0	10	-3.794367	outer membrane porin L; putative sulpholipid
b3874	1	10	-3.250523	putative sulphoquinovose importer

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3868	HTHFIS	59	8e-15	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 59.1 bits (143), Expect = 8e-15 Identities = 16/44 (36%), Positives = 23/44 (52%) Query: 1 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALA 44 M + V DDD++IR VL +AL+ AG N A + +A Sbjct: 1 MTGATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIA 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3871	TCRTETOQM	40	3e-08	Tetracycline resistance protein TetO/TetQ/TetM family ...
>TCRTETOQM#Tetracycline resistance protein TetO/TetQ/TetM family signature. Length = 639 Score = 40.2 bits (94), Expect = 3e-08 Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 4 KLRNIAIIAHVDHGKTTLVDKLLQQSGTFDS 34 K+ NI ++AHVD GKTTL + LL SG Sbjct: 2 KIINIGVLAHVDAGKTTLTESLLYNSGAITE 32

b3931

b3942

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b3931	1	13	3.019633	essential cell division protein
b3932	3	10	3.284398	Anti-activator for CytR-CRP nucleoside
b3933	2	11	3.329902	Primosome factor n' (replication factor Y)
b3934	0	12	2.897416	50S ribosomal subunit protein L31
b3935	1	16	4.553135	putative lipid binding hydrolase, DUF830 family
b3936	0	18	3.409526	transcriptional repressor,
b3937	-1	18	3.720529	cystathionine gamma-synthase, PLP-dependent
b3938	-1	18	3.796244	Bifunctional aspartokinase/homoserine
b3939	-1	17	3.711749	5,10-methylenetetrahydrofolate reductase
b3941	-2	16	2.391617	catalase-peroxidase HPI, heme b-containing
b3942	-1	17	3.009466	EamA-like transporter family protein

b4033

b4046

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4033	-1	12	-3.201832	maltose transporter subunit
b4034	0	14	-3.964746	maltose transporter subunit
b4035	-1	13	-4.023902	maltose ABC transportor ATPase
b4036	-1	10	-2.721000	maltose outer membrane porin (maltoporin)
b4037	-1	13	-3.088932	maltose regulon periplasmic protein
b4038	0	15	-3.464833	chorismate--pyruvate lyase
b4039	0	13	2.243630	p-hydroxybenzoate octaprenyltransferase
b4040	0	13	1.932834	glycerol-3-phosphate O-acyltransferase
b4041	0	13	2.095917	diacylglycerol kinase
b4042	2	17	-0.720716	transcriptional repressor of SOS regulon
b4043	0	21	-3.583883	oxidative stress resistance protein; putative
b4044	1	20	-2.756882	stress-induced protein, UPF0337 family
b4045	1	23	-5.783201	transcriptional repressor, Zn(II)-binding
b4046	0	20	-3.740175	uncharacterized protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4034	MALTOSEBP	85	3e-24	Maltose binding protein signature.
>MALTOSEBP#Maltose binding protein signature. Length = 396 Score = 85.2 bits (210), Expect = 3e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYN 44 MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYN Sbjct: 1 MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYN 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4036	OMPADOMAIN	23	0.045	OMPA domain signature.
>OMPADOMAIN#OMPA domain signature. Length = 346 Score = 23.0 bits (49), Expect = 0.045 Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 10 LAVAVAAGVMSAQAMAVDFHGYARSGIGW 38 +AVA+A AQA D Y + +GW Sbjct: 8 IAVALAGFATVAQAAPKDNTWYTGAKLGW 36

b4061

b4072

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4061	0	15	-3.575701	superoxide response regulon transcriptional
b4062	-1	14	-0.907978	redox-sensitive transcriptional activator of
b4063	0	15	-0.988534	guanine/hypoxanthine permease, high affinity;
b4064	0	16	0.377198	putative cation/proton antiporter
b4065	0	15	-0.218084	pentapeptide repeats protein
b4066	-1	15	-0.992124	acetate transporter
b4067	-2	21	3.231951	DUF485 family inner membrane protein
b4068	-2	20	3.446527	acetyl-CoA synthetase
b4069	-2	18	4.176052	nitrite reductase, formate-dependent,
b4070	-1	16	3.635404	nitrite reductase, formate-dependent, penta-heme
b4071	0	19	4.132206	formate-dependent nitrite reductase, 4Fe4S
b4072	0	19	3.699808	formate-dependent nitrite reductase, membrane

b4090

b4102

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4090	2	29	6.646245	putative periplasmic protein
b4487	1	34	7.899783	5-phospho-alpha-D-ribosyl 1,2-cyclic phosphate
b4092	0	36	8.470353	aminoalkylphosphonate N-acetyltransferase
b4093	0	38	8.255831	ribose 1,5-bisphosphokinase
b4094	1	40	8.976645	ribophosphonate triphosphate hydrolase
b4095	0	40	9.047185	ribophosphonate triphosphate synthase subunit;
b4096	0	38	9.126801	carbon-phosphorus lyase complex subunit,
b4097	0	38	9.387587	carbon-phosphorus lyase, SAM-dependent
b4098	0	37	9.527468	ribophosphonate triphosphate synthase complex
b4099	2	37	8.794950	ribophosphonate triphosphate synthase subunit
b4100	2	37	7.931319	ribophosphonate triphosphate synthase subunit
b4101	2	34	6.918346	putative DNA-binding transcriptional regulator
b4102	2	34	5.473266	phosphonate ABC transporter periplasmic binding

b4124

b4138

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4124	1	17	-4.954718	putative 4Fe-4S mono-cluster protein
b4125	1	13	-5.177140	GNAT family putative N-acetyltransferase
b4126	-1	17	-4.893668	antitoxin of GhoTS toxin-antitoxin pair;
b4127	0	17	-4.740876	toxin of GhoTS toxin-antitoxin pair;
b4128	1	22	-4.051599	lysine tRNA synthetase, inducible
b4559	1	19	-4.682769	dipeptide and tripeptide permease
b4129	1	19	-4.533428	lysine decarboxylase, acid-inducible
b4130	1	18	-4.094811	putative lysine/cadaverine transporter
b4131	1	17	-3.231392	cadBA operon transcriptional activator
b4132	2	17	-2.746462	*putative transcriptional regulator
b4133	1	15	-2.012936	thiol:disulfide interchange protein and
b4654	2	21	0.014761	divalent-cation tolerance protein, copper
b4135	1	19	-0.068202	C4-dicarboxylate antiporter
b4136	1	15	-0.092655	aspartate ammonia-lyase
b4137	1	21	-1.158339	suppressor of F exclusion of phage T7
b4138	2	34	-0.565354	putative transporter

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4133	TYPE3OMOPROT	24	0.024	Type III secretion system outer membrane O protein ...
>TYPE3OMOPROT#Type III secretion system outer membrane O protein family signature. Length = 303 Score = 23.8 bits (51), Expect = 0.024 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 10 EWLVTPSINQISRNGRQLTLE 30 EWL+ + + R+GR+ TLE Sbjct: 12 EWLLAQTATECQRHGREATLE 32
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4135	HTHTETR	26	0.004	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 26.1 bits (57), Expect = 0.004 Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 3 REDVLGEALKLLELQGIANTTLEMVAERVDYPLDELRRFWPD 44 R+ +L AL+L QG+++T+L +A+ + + D Sbjct: 13 RQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKD 54
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4141	MALTOSEBP	25	0.006	Maltose binding protein signature.
>MALTOSEBP#Maltose binding protein signature. Length = 396 Score = 25.5 bits (55), Expect = 0.006 Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 8 LGLAQGIGLLSTSLLGTGVFAVPALAALVAGNNSLW 43 + + G +L+ S L T +F+ ALA + G +W Sbjct: 1 MKIKTGARILALSALTTMMFSASALAKIEEGKLVIW 36

b4670

b4181

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4670	-1	14	3.320512	tRNA(ANN) t(6)A37 threonylcarbamoyladenosine
b4166	-2	13	3.199421	N-acetylmuramoyl-l-alanine amidase II
b4167	-2	13	3.329675	methyl-directed mismatch repair protein
b4168	-1	14	2.575324	delta(2)-isopentenylpyrophosphate tRNA-adenosine
b4169	0	12	3.029529	global sRNA chaperone; HF-I, host factor for RNA
b4170	1	14	2.709845	GTPase, stimulated by 50S subunit binding;
b4171	2	19	1.853235	modulator for HflB protease specific for phage
b4172	5	25	1.949168	HflB protease modulator specific for phage
b4173	5	23	1.804026	DUF2065 family protein
b4174	4	23	2.364338	adenylosuccinate synthetase
b4175	5	23	2.204046	nitric oxide-sensitive repressor for NO regulon
b4176	3	19	1.256757	exoribonuclease R, RNase R
b4177	3	18	1.189526	23S rRNA mG2251 2'-O-ribose methyltransferase,
b4178	4	13	0.291989	DUF2170 family protein
b4179	4	13	-0.044032	PspA/IM30 family protein
b4180	4	16	-2.962470	DUF2491 family protein
b4181	2	17	-3.143328	UPF0719 family inner membrane protein

b4193

b4201

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4193	0	29	3.130975	3-keto-L-gulonate 6-phosphate decarboxylase
b4194	-2	26	3.187057	L-xylulose 5-phosphate 3-epimerase
b4196	-2	21	3.187640	L-ribulose 5-phosphate 4-epimerase
b4197	-2	21	2.490614	YhcN family protein, periplasmic
b4198	1	27	0.749730	30S ribosomal subunit protein S6
b4199	2	30	-3.835677	primosomal protein N
b4200	0	29	-5.014727	30S ribosomal subunit protein S18
b4201	-1	24	-3.805631	50S ribosomal subunit protein L9

b4246

b4253

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4246	4	38	-9.331024	biofilm modulator regulated by toxins; DUF386
b4248	3	30	-7.600287	SopA-central-domain-like hexapeptide repeat
b4249	3	27	-7.446048	ornithine carbamoyltransferase 1
b4251	3	26	-8.130357	protein inhibitor of RNase E
b4252	2	29	-10.200327	GNAT family putative N-acetyltransferase
b4253	0	17	-5.949529	DUF898 family inner membrane protein

b4271

b4291

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4271	4	31	-0.676275	IS4 transposase
b4272	4	32	-2.778736	putative MFS transporter, membrane protein
b4273	5	34	-4.917074	GFO/IDH/MOCA family putative oxidoreductase.
b4575	6	37	-6.683123	uncharacterized protein
b4277	7	36	-7.368732	IS30 transposase
b4278	7	35	-8.187440	ferric citrate ABC transporter ATPase
b4279	7	46	-12.631799	ferric citrate ABC transporter permease
b4280	5	38	-9.059644	ferric citrate ABC transporter permease
b4655	5	38	-6.668368	ferric citrate ABC transporter periplasmic
b4281	5	37	-4.782615	TonB-dependent outer membrane ferric citrate
b4282	4	34	-3.052016	anti-sigma transmembrane signal transducer for
b4623	2	26	-0.221388	RNA polymerase sigma-19 factor, fec
b4284	3	21	2.303298	IS1 repressor TnpA
b4561	3	17	5.329488	putative DNA-binding transcriptional regulator;
b4286	1	23	6.306464	putative transporter
b4287	2	23	6.627088	putative dehydratase
b4288	2	25	6.834872	putative lyase/synthase
b4289	2	26	6.393356	putative DNA-binding transcriptional regulator
b4290	1	25	5.431904	putative DNA-binding transcriptional regulator
b4291	1	22	4.136796	putative epimerase

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4279	BONTOXILYSIN	25	0.012	Bontoxilysin signature.
>BONTOXILYSIN#Bontoxilysin signature. Length = 1196 Score = 24.9 bits (54), Expect = 0.012 Identities = 7/25 (28%), Positives = 9/25 (36%) Query: 7 KQVNPPQRKALFSAWLGYVFDGFDF 31 K P + WL VF + F Sbjct: 547 KNDGPIDTDKKYYLWLKEVFKNYSF 571

b4301

b4317

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4301	2	18	0.892186	N-acetylneuraminic acid mutarotase
b4302	3	17	0.398186	N-acetylnuraminic acid outer membrane channel
b4303	1	18	1.401226	tyrosine recombinase/inversion of on/off
b4304	2	18	1.658184	tyrosine recombinase/inversion of on/off
b4565	1	21	2.062200	major type 1 subunit fimbrin (pilin)
b4305	1	21	1.615312	fimbrial protein involved in type 1 pilus
b4656	0	26	-1.586153	periplasmic chaperone
b4306	0	25	-2.030421	fimbrial usher outer membrane porin protein;
b4307	1	29	-5.120811	minor component of type 1 fimbriae
b4566	0	28	-6.744906	minor component of type 1 fimbriae
b4657	1	30	-7.185993	minor component of type 1 fimbriae
b4308	1	30	-6.799964	fructuronate transporter
b4309	1	30	-5.708541	mannonate hydrolase
b4310	1	30	-5.916260	D-mannonate oxidoreductase, NAD-dependent
b4311	2	31	-5.675533	fructuronate-inducible hexuronate regulon
b4312	2	28	-4.126185	uncharacterized protein
b4313	1	27	-3.492553	RpoS stabilzer after DNA damage, anti-RssB
b4314	2	25	-2.964638	hypochlorite-responsive transcription factor
b4315	3	24	-3.033672	isoaspartyl dipeptidase
b4316	3	17	-2.212505	SpmB family inner membrane protein
b4317	2	12	-0.900676	nucleoside recognition pore and gate family

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4317	PF00577	69	3e-18	Outer membrane usher protein FimD
>PF00577#Outer membrane usher protein FimD Length = 878 Score = 68.7 bits (168), Expect = 3e-18 Identities = 43/44 (97%), Positives = 43/44 (97%) Query: 1 MSYLNLRLYQRNTQCLHIRKHRLAGFFVRLVVACAFAAQAPLSS 44 MSYLNLRLYQRNTQCLHIRKHRLAGFFVRL VACAFAAQAPLSS Sbjct: 1 MSYLNLRLYQRNTQCLHIRKHRLAGFFVRLFVACAFAAQAPLSS 44

b4333

b4345

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
b4333	2	17	-0.283318	methylated adenine and cytosine restriction
b4334	2	19	1.584089	metal-binding GTPase
b4335	2	21	1.262438	DUF466 family protein
b4336	0	18	-0.830916	putative transporter
b4337	0	17	-1.476700	methyl-accepting chemotaxis protein I, serine
b4339	1	21	-3.697050	putative L-galactonate:H+ symporter
b4340	2	21	-5.046886	putative transcriptional activator for
b4341	3	26	-6.224062	L-galactonate oxidoreductase; L-gulonate
b4342	3	29	-7.259893	OPG periplasmic biosynthetic phosphoglycerol
b4486	1	17	-5.347431	putative DUF2501 family periplasmic protein
b4345	0	11	-3.618923	DNA biosynthesis protein

b4381

b4387

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b4381	0	23	3.018607	right oriC-binding transcriptional activator,
b4382	0	20	3.035605	putative periplasmic protein
b4383	-2	19	3.260307	response regulator in two-component regulatory
b4384	-2	15	4.008484	sensory histidine kinase in two-component
b4385	-2	15	3.468551	inner membrane protein
b4386	0	20	3.615340	response regulator in two-component regulatory
b4387	-2	17	3.082176	uncharacterized protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4398	HTHFIS	34	4e-06	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 34.4 bits (79), Expect = 4e-06 Identities = 8/34 (23%), Positives = 15/34 (44%) Query: 1 MQRETVWLVEDEQGIADTLVYMLQQEGFAVEVFE 34 M T+ + +D+ I L L + G+ V + Sbjct: 1 MTGATILVADDDAAIRTVLNQALSRAGYDVRITS 34
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b4401	HTHFIS	40	4e-08	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 40.2 bits (94), Expect = 4e-08 Identities = 11/44 (25%), Positives = 20/44 (45%) Query: 1 MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILS 44 M IL+ +D+ R L GYDV ++ A + + ++ Sbjct: 1 MTGATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIA 44

b1075

b1083

Pathogenicity Island (unbiased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1075	2	12	2.344325	flagellar hook protein
b1076	0	12	2.375256	flagellar component of cell-proximal portion of
b1077	-1	12	2.259536	flagellar component of cell-distal portion of
b1078	0	9	1.113709	flagellar protein of basal-body outer-membrane L
b1079	0	13	2.045669	putative flagellar basal body protein
b1081	1	15	1.372129	flagellar rod assembly protein and murein
b1082	2	15	0.953579	flagellar hook-filament junction protein 1
b1083	3	17	0.944183	flagellar hook-filament junction protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1076	FLGHOOKAP1	29	4e-04	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 28.8 bits (64), Expect = 4e-04 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 6 AVSGLNAAATNLDVIGNNIANSATYGFK 33 A+SGLNAA L+ NNI++ G+ Sbjct: 7 AMSGLNAAQAALNTASNNISSYNVAGYT 34
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1078	FLGHOOKAP1	40	4e-08	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 39.9 bits (93), Expect = 4e-08 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 3 SSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAV 40 S + A +GL+A Q ++ +NN+++ + G+ RQ + Sbjct: 2 SLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTI 39
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1079	FLGLRINGFLGH	77	8e-22	Flagellar L-ring protein signature.
>FLGLRINGFLGH#Flagellar L-ring protein signature. Length = 232 Score = 76.9 bits (189), Expect = 8e-22 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT 44 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT Sbjct: 1 MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPT 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1080	FLGPRINGFLGI	51	5e-12	Flagellar P-ring protein signature.
>FLGPRINGFLGI#Flagellar P-ring protein signature. Length = 373 Score = 51.1 bits (122), Expect = 5e-12 Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 4 FLSALILLLVTTAAQAERIRDLTSVQGVRQNSLIGYGLVVG 44 F + L A RI+D+ S+Q R N LIGYGLVVG Sbjct: 13 FSALPFLSTPPAQADTSRIKDIASLQAGRDNQLIGYGLVVG 53
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1081	FLGFLGJ	76	7e-21	Flagellar protein FlgJ signature.
>FLGFLGJ#Flagellar protein FlgJ signature. Length = 313 Score = 75.5 bits (185), Expect = 7e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF 44 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF Sbjct: 1 MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMF 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1082	FLGHOOKAP1	54	5e-13	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 53.8 bits (129), Expect = 5e-13 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 2 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA 44 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA Sbjct: 1 SSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQA 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1083	FLAGELLIN	25	0.014	Flagellin signature.
>FLAGELLIN#Flagellin signature. Length = 507 Score = 24.6 bits (53), Expect = 0.014 Identities = 9/36 (25%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query: 7 MMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDD 42 ++ Q N+ +S + + E++S+G R+ + DD Sbjct: 11 LLTQNNLNKSQSSLSSAI---ERLSSGLRINSAKDD 43

b1930

b1948

Pathogenicity Island (unbiased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b1930	2	32	-7.748792	putative TusA family sulfurtransferase
b1931	-1	23	-4.018705	DUF159 family protein
b1932	1	17	-2.951168	GNAT family putative N-acetyltransferase
b4495	1	15	-1.641705	flagellar basal-body component
b1936	0	15	4.154652	flagellar basal-body MS-ring and collar protein
b1937	1	15	3.973545	flagellar motor switching and energizing
b1938	1	14	3.897287	negative regulator of FliI ATPase activity
b1939	2	16	4.045475	flagellum-specific ATP synthase
b1940	0	17	3.594171	flagellar protein
b1941	-1	18	3.332176	flagellar hook-length control protein
b1942	-1	16	2.054675	flagellar biosynthesis protein
b1943	-1	16	2.164939	flagellar motor switching and energizing
b1944	-3	20	1.563191	flagellar motor switching and energizing
b1945	0	16	0.265721	flagellar biosynthesis protein
b1946	0	16	-2.844432	flagellar biosynthesis protein
b1947	0	17	-3.542428	flagellar biosynthesis protein
b1948	0	19	-4.330579	flagellar export pore protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1930	PF01206	54	2e-14	SirA family protein
>PF01206#SirA family protein Length = 76 Score = 54.0 bits (130), Expect = 2e-14 Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 7 DYRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCP 44 D LD G CP P + + + + GE+L V++ P Sbjct: 5 DQSLDATGLNCPLPILKAKKTLATMNAGEVLYVMATDP 42
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1937	FLGHOOKFLIE	52	3e-13	Flagellar hook-basal body complex protein FliE signa...
>FLGHOOKFLIE#Flagellar hook-basal body complex protein FliE signature. Length = 103 Score = 52.0 bits (124), Expect = 3e-13 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 2 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR 44 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR Sbjct: 1 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDR 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1938	FLGMRINGFLIF	62	6e-16	Flagellar M-ring protein signature.
>FLGMRINGFLIF#Flagellar M-ring protein signature. Length = 559 Score = 61.9 bits (150), Expect = 6e-16 Identities = 33/42 (78%), Positives = 39/42 (92%) Query: 3 ATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAK 44 +TA Q K LEWLNRLRANP+IPLIVAGSAAVA++VA++LWAK Sbjct: 5 STATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAK 46
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1939	FLGMOTORFLIG	58	2e-14	Flagellar motor switch protein FliG signature.
>FLGMOTORFLIG#Flagellar motor switch protein FliG signature. Length = 344 Score = 57.9 bits (140), Expect = 2e-14 Identities = 19/44 (43%), Positives = 34/44 (77%) Query: 1 MSNLTGTDKSVILLMTIGEDRAAEVFKHLSQREVQTLSAAMANV 44 +S LTG K+ ILL++IG + +++VFK+LSQ E+++L+ +A + Sbjct: 12 VSALTGKQKAAILLVSIGSEISSKVFKYLSQEEIESLTFEIAKL 55
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1940	FLGFLIH	74	8e-21	Flagellar assembly protein FliH signature.
>FLGFLIH#Flagellar assembly protein FliH signature. Length = 228 Score = 74.1 bits (181), Expect = 8e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL 44 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL Sbjct: 1 MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQL 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1942	FLGFLIJ	68	5e-19	Flagellar FliJ protein signature.
>FLGFLIJ#Flagellar FliJ protein signature. Length = 147 Score = 67.9 bits (165), Expect = 5e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID 44 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID Sbjct: 1 MAEHGALATLKDLAEKEVEDAARLLGEMRRGCQQAEEQLKMLID 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1943	FLGHOOKFLIK	58	1e-14	Flagellar hook-length control protein signature.
>FLGHOOKFLIK#Flagellar hook-length control protein signature. Length = 375 Score = 58.3 bits (140), Expect = 1e-14 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD 44 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD Sbjct: 1 MIRLAPLITADVDTTTLPGGKASDAAQDFLALLSEALAGETTTD 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1945	FLGMOTORFLIM	48	5e-11	Flagellar motor switch protein FliM signature.
>FLGMOTORFLIM#Flagellar motor switch protein FliM signature. Length = 344 Score = 48.4 bits (115), Expect = 5e-11 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Query: 5 ILSQAEIDALLNGDS--EVKDEPTASVSGESDIRPYDPNTQR 44 +LSQ EID LL S + E +S I YD Sbjct: 4 VLSQDEIDQLLTAISSGDASIEDARPISDTRKITLYDFRRPD 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1946	FLGMOTORFLIN	80	7e-24	Flagellar motor switch protein FliN signature.
>FLGMOTORFLIN#Flagellar motor switch protein FliN signature. Length = 137 Score = 79.9 bits (197), Expect = 7e-24 Identities = 32/44 (72%), Positives = 41/44 (93%) Query: 1 MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGG 44 MSDMNNP+D+N GA+DDLWA+AL+EQK+T++KSAA+ VFQQ GG Sbjct: 1 MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGG 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1948	FLGBIOSNFLIP	59	5e-15	Escherichia coli: Flagellar biosynthetic protein Fl...
>FLGBIOSNFLIP#Escherichia coli: Flagellar biosynthetic protein FliP signature. Length = 245 Score = 59.1 bits (143), Expect = 5e-15 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT 44 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT Sbjct: 1 MRRLLSVAPVLLWLITPLAFAQLPGITSQPLPGGGQSWSLPVQT 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1949	RTXTOXINA	31	6e-05	Gram-negative bacterial RTX toxin determinant A family...
>RTXTOXINA#Gram-negative bacterial RTX toxin determinant A family signature. Length = 1024 Score = 31.1 bits (70), Expect = 6e-05 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 10 GTEAMKVALALAAPL-LLVALVTGLIISILQAATQ 43 G A + AP+ LV VTG+I IL+A+ Q Sbjct: 381 GISAAATTSLVGAPVSALVGAVTGIISGILEASKQ 415
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b1950	TYPE3IMRPROT	52	2e-12	Type III secretion system inner membrane R protein ...
>TYPE3IMRPROT#Type III secretion system inner membrane R protein family signature. Length = 261 Score = 51.7 bits (124), Expect = 2e-12 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL 44 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL Sbjct: 1 MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKL 44

b3321

b3328

Pathogenicity Island (unbiased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
b3321	1	20	-2.409435	general secretory pathway component, cryptic
b3322	1	21	-2.402542	general secretory pathway component, cryptic
b3323	1	20	-2.251637	general secretory pathway component, cryptic
b3324	1	20	-1.593651	pseudopilin, cryptic, general secretion pathway
b3325	0	18	-0.668916	putative general secretory pathway component,
b3326	1	22	-0.352407	general secretory pathway component, cryptic
b3327	2	23	-1.025736	putative general secretory pathway component,
b3328	3	24	-1.720715	general secretory pathway component, cryptic

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3325	BCTERIALGSPD	44	2e-09	Bacterial general secretion pathway protein D signa...
>BCTERIALGSPD#Bacterial general secretion pathway protein D signature. Length = 660 Score = 43.8 bits (103), Expect = 2e-09 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Query: 7 ITCCLLAALLMPCAGHAENEQYGANFNNADIRQFVEIV 44 +T + AALL A E++ A+F DI++F+ V Sbjct: 12 LTLLIFAALLF---RPAAAEEFSASFKGTDIQEFINTV 46
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3327	BCTERIALGSPF	57	5e-14	Bacterial general secretion pathway protein F signa...
>BCTERIALGSPF#Bacterial general secretion pathway protein F signature. Length = 408 Score = 56.8 bits (137), Expect = 5e-14 Identities = 17/43 (39%), Positives = 24/43 (55%) Query: 2 NYRYRAMTQDGQKLQGIIDANDERQARLRLREEGLFLLDIRPQ 44 Y Y+A+ G+K +G +A+ RQAR LRE GL L + Sbjct: 3 QYHYQALDAQGKKCRGTQEADSARQARQLLRERGLVPLSVDEN 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3328	BCTERIALGSPG	84	2e-25	Bacterial general secretion pathway protein G signa...
>BCTERIALGSPG#Bacterial general secretion pathway protein G signature. Length = 145 Score = 83.8 bits (207), Expect = 2e-25 Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MRATDKQRGFTLLEIMVVIVIIGVLASLVVPNLMGNKEKADKQK 44 MRATDKQRGFTLLEIMVVIVIIGVLASLVVPNLMGNKEKADKQK Sbjct: 1 MRATDKQRGFTLLEIMVVIVIIGVLASLVVPNLMGNKEKADKQK 44
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3329	BCTERIALGSPH	51	2e-12	Bacterial general secretion pathway protein H signa...
>BCTERIALGSPH#Bacterial general secretion pathway protein H signature. Length = 170 Score = 51.1 bits (122), Expect = 2e-12 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Query: 3 QQRGFTLLEMMLVLALVAITASVVLFTY--GREDVAS-TRARETA 44 +QRGFTLLEMML+L L+ ++A +VL + R+D A+ T AR A Sbjct: 2 RQRGFTLLEMMLILLLMGVSAGMVLLAFPASRDDSAAQTLARFEA 46
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3330	BCTERIALGSPG	30	1e-04	Bacterial general secretion pathway protein G signa...
>BCTERIALGSPG#Bacterial general secretion pathway protein G signature. Length = 145 Score = 30.2 bits (68), Expect = 1e-04 Identities = 10/39 (25%), Positives = 23/39 (58%) Query: 1 MNKQSGMTLLEVLLAMSIFTAVALTLMSSMQGQRNAIER 39 +KQ G TLLE+++ + I +A ++ ++ G + ++ Sbjct: 4 TDKQRGFTLLEIMVVIVIIGVLASLVVPNLMGNKEKADK 42
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3331	BCTERIALGSPG	36	1e-06	Bacterial general secretion pathway protein G signa...
>BCTERIALGSPG#Bacterial general secretion pathway protein G signature. Length = 145 Score = 35.6 bits (82), Expect = 1e-06 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 3 NRQQGFTLLEVMAALAIFSMLSVL 26 ++Q+GFTLLE+M + I +L+ L Sbjct: 5 DKQRGFTLLEIMVVIVIIGVLASL 28
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
b3332	BCTERIALGSPH	25	0.008	Bacterial general secretion pathway protein H signa...
>BCTERIALGSPH#Bacterial general secretion pathway protein H signature. Length = 170 Score = 25.3 bits (55), Expect = 0.008 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 5 QRGVALLIVLMLLALMAALAADMTLSF 31 QRG LL ++++L LM A + L+F Sbjct: 3 QRGFTLLEMMLILLLMGVSAGMVLLAF 29


Contact Sachin Pundhir for Bugs/Comments. For best view 1024 x 768 resolution & IE 6.0 or above recommended.