set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 0
res_num 1 0=NaN 1=1 146=NaN , Q62669
res_secstru 0=_ 4=H 36=_ 37=H 43=_ 57=H 78=_ 80=H 96=_ 100=H 142=_ , Q62669
res_chain 0=_ 1=B , Q62669
accession_id UNIPROT:Q62669 , Q62669
#----------
project_coordinates AUTO , UNIREF:Q62669
# Deleted commands: [load ]
#end_of_script_1378667367825_
| /\/\/\/\/\/\/\/\/\/\/\/\/\/\/\/\ \/\/\/ \/\
|
| Q62669 | mVHLTDAEKATVNGLWGKVNPVEIGAESLASLLIVYPWTQRYFSKFGDLSSVSAIMGNPQ - --- - - -- - -- - - |
| /\/\/\/\/\/\/\/\/\ /\/\/\/\/\/\/\/\ /\/\/\/\/\/\/\/\/\/\
|
| VKAHGKKVINAFDDGLKHLDNLKGTFGSLSELHCDKLHVDPENFRLLGNMIVIMMGHHLG - -- -- |
| /\/\/\/\/\/\/\/\/\/\/\
|
| KEFTPSAQAAFQKVVAGVASALAHKYh - |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.