/\/\/\/\/\/\/  \/\/\/\/\/\/\/\/\/\/\/\/\/\/   /\/\/\/\/\
HBB_HORSE
 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPK
HBB_SHEEP
 M.LTAEEKAAVTGFWGKVKVDEVGAEALGRLLVVYPWTQRFFEHFGDLSNADAVMNNPK
HBB_RABIT
 VHLSSEEKSAVTALWGKVNVEEVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPK
HBB_ANSIN
 VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPM
HBB_MACFA
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
/\/\/\/\/\/\/\/\/\  /\/\/\/\/\/\/\/\    /\/\/\/\/\/\/\/\/\/\
VKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFG
VKAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHHG
VKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFG
VRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFA
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
/\/\/\/\/\/\/\/\/\/\/\/\/\/
KDFTPELQASYQKVVAGVANALAHKYH
NEFTPVLQADFQKVVAGVANALAHKYH
KEFTPQVQAAYQKVVAGVANALAHKYH
KEFTPDCQAAWQKLVRVVAHALARKYH
KEFTPPVQAAYQKVVAGVANALAHKYH
If you see this text, then Java-Script did not work

Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer

License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.

Designed with Alignment program Alignments in Web pages