set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 0
#----------
new_selection Canus/My_Feature, myFeatures, 11
new_selection Canus/My_Other_Feature, myFeatures, 13
feature_colors My_Feature=#FF0000 My_Other_Feature=#ffFF00,#889900
# Deleted commands: [aa_sequence ]
#end_of_script_1378667409630_
| |
| Canus | MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFP - - |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.