Canus
MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFP
          - -
If you see this text, then Java-Script did not work

Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer

License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.

Designed with Strap Alignments to HTML
  MFMy_Feature