Bioinformatics.org
[Regeneron]
Not logged in
  • Log in
  • Bioinformatics.org
    Membership (41326+) Group hosting [?] Wiki
    Franklin Award
    Sponsorships

    Careers
    About bioinformatics
    Bioinformatics training
    Bioinformatics jobs

    Research
    All information groups
    Online databases Online analysis tools Online education tools More tools

    Development
    All software groups
    FTP repository
    SVN & CVS repositories [?]
    Mailing lists

    Forums
    News & Commentary
  • Submit
  • Archives
  • Subscribe

  • Jobs Forum
    (Career Center)
  • Submit
  • Archives
  • Subscribe
  • News & Commentary - Message forums

    URL: gp2fasta service
    Submitted by Lukasz Pawel Kozlowski; posted on Tuesday, August 07, 2007

    gp2fasta is a tool for converting gp files from NCBI GenPept format to fasta. Its main purpose is to create fasta files with short, but still accurate headers for sequence. Additionally, you can download a free stand-alone version of gp2fasta written in QT4 library.

    For example:
    Strpur-115729834-h
    PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

    stands for:
    gi: 115729834
    organism: Strongylocentrotus purpuratus
    additional: h (hypothetical protein)
    sequence:PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

    URL: gp2fasta.ovh.org
    Discussion forums: URL: gp2fasta service

    Expanded view | Monitor forum | Save place

    Start a new thread:
    You have to be logged in to post a reply.

     

    Copyright © 2019 · Scilico, LLC