• [Photo] Lukasz Pawel Kozlowski August 7, 2007
    gp2fasta is a tool for converting gp files from NCBI GenPept format to fasta. Its main purpose is to create fasta files with short, but still accurate headers for sequence. Additionally, you can download a free stand-alone version of gp2fasta written in QT4 library.

    For example:
    >Strpur-115729834-h
    PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

    stands for:
    gi: 115729834
    organism: Strongylocentrotus purpuratus
    additional: h (hypothetical protein)
    sequence:PNQILMQFRLDDNGSSYYKELASIIYGASPEFELAIFTVCFKENPNALSTFTMAGGITQKVQTWDYNGGYIGSAYFSV

    URL: http://gp2fasta.ovh.org

Discussion forums: URL: gp2fasta service

Expanded view | Monitor forum | Save place

Start a new thread:

You have to be logged in to post a reply.

© 1998-2025 Scilico, LLC. All rights reserved.